SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007350 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007350
Domain Number 1 Region: 20-144
Classification Level Classification E-value
Superfamily PH domain-like 2.62e-19
Family Phosphotyrosine-binding domain (PTB) 0.083
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007350
Domain Number - Region: 290-413
Classification Level Classification E-value
Superfamily Tropomyosin 0.0085
Family Tropomyosin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007350   Gene: ENSMPUG00000007408   Transcript: ENSMPUT00000007470
Sequence length 506
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896900.1:21857678:21888091:1 gene:ENSMPUG00000007408 transcript:ENSMPUT00000007470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTSKSNSVSPSPSLEQTDSDALDISTKVQLYGVLWKRPFGRPSAKWSRRFFIIKESFLL
YYSESEKKNFESNKYFNIHPKGVIPLGGCLVEAREEPSMPYAMKISHQDFHGNILLAAES
EFEQTQWLEMLQESGKVTWKNAQLGEAMIKSLEAQGLQLAKEKQEYLDKLMEETEELCLQ
REQREELERLNQVLEAEKQQFEEVVQELKMEQEQIKRELELTARCLKGVEQEKKELRHLT
ESLQQTLEELSIEKKKTLAMLEENENQLQTLANQSEQPPPSGCLHSNLRQIEEKMQQLLE
EKLLAEKRMKENEERSRALEEEREFYSTQSQALQNSLQELTAEKQQAERELKAEVKVRMD
LERRLREAEGALRSLEQGLNSKVRNKEKEERMRADVSHLKRFFEECIRNAELEAKMPVIM
KNSVYIHKAATRRIKSCRFHRRRSSTSWNDMKPSQSFMTSQLDANNMEELKEVAKRLSRD
QRFRESIYHIMANQPGAPSVAPRGGK
Download sequence
Identical sequences M3Y7P3
ENSMPUP00000007350 ENSMPUP00000007350 XP_004739073.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]