SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007354 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007354
Domain Number 1 Region: 291-462
Classification Level Classification E-value
Superfamily p53-like transcription factors 7.46e-59
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000207
Further Details:      
 
Domain Number 2 Region: 461-571
Classification Level Classification E-value
Superfamily E set domains 1.51e-30
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007354   Gene: ENSMPUG00000007412   Transcript: ENSMPUT00000007474
Sequence length 1553
Comment pep:known scaffold:MusPutFur1.0:GL896910.1:20185931:20295287:1 gene:ENSMPUG00000007412 transcript:ENSMPUT00000007474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSDFISLLSADLDLESPKSLYSRDSLKLHPSQNFHRAGLLEESVYDLLPKELQLPPSRE
TSVASMSQTSGGEAGSPPPAVVAADASSAPSSSSMGGACSSFTTSSSPTIYSTSVTDSKA
MQVESCSSALGVSNRGVSEKQLTSNTVQQHPSTPKRHTVLYISPPPEDLLDNSRMSCQDE
GCGLESEQSCSMWMEDSPSNFSNMSTSSYNDNTEVPRKSRKRNPKQRPGVKRRDCEESNM
DIFDADSAKAPHYVLSQLTTDNKGNSKAGNGTLENQKGSGVKKSPMLCGQYPVKSEGKEL
KIVVQPETQHRARYLTEGSRGSVKDRTQQGFPTVKLEGHNEPVVLQVFVGNDSGRVKPHG
FYQACRVTGRNTTPCKEVDIEGTTVIEVGLDPSNNMTLAVDCVGILKLRNADVEARIGIA
GSKKKSTRARLVFRVNITRKDGSTLTLQTPSSPILCTQPAGVPEILKKSLHSCSVKGEEE
VFLIGKNFLKGTKVIFQENVSDENSWKSEAEIDMELFHQNHLIVKVPPYHDQHITLPVSV
GIYVVTNAGRSHDVQPFTYTPDPATAGALNVNVKKEISSPSRPCSFEEAMKAMKTTGCNL
DKVNILPNALITPLISSSMIKSEDVTPMEVTAEKRSSPIFKTTKTVGSTQQTLENISNIA
GNGSFSSSSSSHLPSENEKQQQIQPKTYNPETLTTIQTQDISQPGTFPAVSASSQLPTSD
ALLQQATQFQTRETQSREVLQSDGTVVNLSHLTESSQPQQQSPLQEQAQTLQQQISSNIF
PSPNSVSQLQNTIQHLQAGSFTGSTASGSSGNVDLVQQVLEAQQQLSSVLFSAPDGNENV
QEQLSADIFQQVSQIQNSVSPGMFSSTEPAVHTRPDNLIAGRAESVHPPTENTLSSQQQQ
QQQQQVMESSAAMVMEMQQSICQAAAQIQSELFPSPASANGNLQQSPVYQQTSHIISALS
TNEDMQMQCELFSSPPAVSGNETTTTTTQQVATPGTTMFQTSSSGDGEEPGAQAKQIQNS
VFQTMVQMQHSGDSQSQVNLFSSTKSMMSVQNNGTQQQGNGLFQQGNEMMSLQSGNFLQQ
SSHSQAPLFHPQNPIADAQNLSQETQGSIFHSPSPIVHSQTSTTSSEQMQPPMFHSQSTM
AVLQGSSVPQDQQSANLFLSQSPMNNLQSNTVAQEEQISFFAAQNSISPLQSTSNTEQQA
GFQQQAPISHIQTPMLSQEQAQPSQQGMFQPQVSLGSLPPNPMPQNQQGTIFQSQHSIVA
IQSNSPSQEQQQQQQQQQQQQQQQQQQQSILFSNQNTMATMASQKQPPPNMMFNPSQNPM
ANQEQQNQSIFHQQNNMAPMNQEQQPMQFQNQPPVSSLQNPGSTQSESPQTSLFHTSPQI
QLVQGSPNSQEQQVTLFLSPASMSALQTSMNQQDMQQSPLYSPQNNMPGIQGATSSPQPQ
ATLFHNTTGGTMNQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQ
PQNEGQPPVTTLLSQQMPENSSLASSINANQNIEKIDLLVSLQNQGNNLTGTF
Download sequence
Identical sequences M3Y7P7
XP_004744602.1.14098 ENSMPUP00000007354 ENSMPUP00000007354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]