SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007395 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007395
Domain Number 1 Region: 1182-1307
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.85e-26
Family Synaptotagmin-like (S variant) 0.0075
Further Details:      
 
Domain Number 2 Region: 1621-1729
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.28e-24
Family Synaptotagmin-like (S variant) 0.0095
Further Details:      
 
Domain Number 3 Region: 2-132
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.14e-24
Family Synaptotagmin-like (S variant) 0.056
Further Details:      
 
Domain Number 4 Region: 247-380
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.77e-20
Family Synaptotagmin-like (S variant) 0.019
Further Details:      
 
Domain Number 5 Region: 1833-1990
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.26e-17
Family Synaptotagmin-like (S variant) 0.016
Further Details:      
 
Domain Number 6 Region: 367-377,409-520
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.14e-17
Family Synaptotagmin-like (S variant) 0.013
Further Details:      
 
Domain Number 7 Region: 1345-1460
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000129
Family PLC-like (P variant) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007395   Gene: ENSMPUG00000007451   Transcript: ENSMPUT00000007515
Sequence length 2133
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896905.1:13131645:13329870:1 gene:ENSMPUG00000007451 transcript:ENSMPUT00000007515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCCLLVRASNLPSVKKDRRSDPVASLTFRGVKKRTKVIKNSVNPVWNEGFEWDLKGIPL
DQSSELHVVVKDHETMGRNRFLGEAQVPLREVLATPSLSASFNAPLLDTKKQPTGASLVL
QVSYTPLPGAVPLFPPSASLEPSPTLPNMDMMAGGGQSRAETWSLLSDSTVDTRNSGKKW
LAPTDTGEDTEDQGFTGDEAEPSLDQSGAPGPGAPTTPRKPPSHPPPYHPGSKRKRSGPT
PRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPVVKVTAAGQTKRTRIHKGNSPLFNETLFF
NVFDSPSELFEEPIFITVVDSRSLRTDALIGEFRMDVGTIYREPRHAYLRKWLLLSDPDD
FSAGARGYLKASLCVLGPGDEAPLERKDPSEDKEDIENNLLRPTGVALRGAHFCLKVFRA
EDLPQMDDAVMDNVKQIFGFDSNKKNLVDPFMEVSFAGKMLCSKILEKTANPQWNQSITL
PAMFPSMCEKMRIRVMDWDRLTHNDIVATTYLSMSKISAPGGEIEEEPAGVVKPSPTMDL
DDHLGFLPTFGPCYVNLYGSPREFTGFPDPYAELNTGKGEGVAYRGRLLLSLETKLVEHS
EQKVEDLPADDILRVEKYLRRRKYSLFAAFYSASMLQDVDDAIQFEVSIGNYGNKFDTTC
LPLASTTQYSRAVFDGCHYYYLPWGNVKPVVVLSSYWEDISHRVETQNQLLRIADRLEAG
LEQVHLAVKAQGNTEDVDSLLAQLLDELISDCSQPLGDVHEIPSATHLDQYLYRLRSRHL
NQMTEAALALKLGHGGLPAALEQAEDWLLRLRALAEEPQNSLPDIIIWMLQGDKRVAYQR
VPARDILFSRRGAKYCGKNCGKLQTLFLKYPMEGVPGARMPVQIRVKLWFGLSVDEKEFN
QFAEGKLSVFAETYENQTKLALVGNWGTTGLTYPKFSDVTGKIKLPKDSFRPSAGWTWAG
DWFVCPEKTLLHDTDAGHLSFVEEVFENQTRLPGGQWIYMSDNYTDVNGEKVLPKDDIEC
PLGWKWEDEEWSTDLNRAVDEQGWEYSITIPPDRKPKHWVPAEKMYYTHRRRRWVRLRRR
DLSQMEALKRHRQAEAEGEGWEYASLFGWKFHLEYRKTDAFRRRRWRRRMEPLEKTGPAA
VFALEGALGGVVDDRSDDSMSVSTLSFGVNRPTISCIFDYGNRYHLRCYMYQARDLPSMD
KDSFSDPYAIVSFLHQSQKTVVAKNTLNPTWDQTLIFYEIEIFGEPASIAEQPPNIVVEM
YDHDTYGADEFMGRCMCQPSLERMPRLAWFPLIRGSQPAGELLASFELIQREKPAIHHIP
GFEVHDTSGILDESEDTDLPYPPPQREANIYMVPQNIKPVLQRTAIEILAWGLRNMKSYQ
LASVSSPSLVVECGGQTVQSCVIKNLRKNPNFDVCTLFMEVMLPREELYCPPIVIKVIDN
RQFGRRPVVGQCTVRSLESFMCDLYSEESPSPQGGPDDVSLLSPGEDVLIDIDDKEPLIP
IQLADGLLGSAPTNMASSPSSLHEEEFIDWWSKFFASTGEREKCGSYLEKGFDTLKVYDT
QLENVEAFEGLSDFCNTFKLYRGKTQEETEDPSVIGEFKGLFKIYPLPEDPAVPMPPRQF
HQLTAQGPQECLVRIYIIRAFGLQPKDPNGKCDPYVKISIGKKSVSDQDNYIPCTLEPVF
GKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVIDLENRLLSKFGARCGLPQTYCVS
GPNQWRDQLRPSQLLQLFCQQRRLKAPVYLTDRVLFQDKEYTIEETEGGRVLNPHLGPVE
ERLALYILRQLGLVPEHVESRPLYSPLQPDIEQGKLQMWIDLFPKALGRPGPPFNITPRR
ARRFFLRCIIWNTKDVILDDLSITGEKMSDIYVKGWMVGFEEHKQKTDVHYRSLGGEGNF
NWRFIFPFDYLPAEQVCTVSKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDDFLGSLQL
DLNHMPKPAKTAEKCSLDQLDDTFHPEWFVSLFEQKTVKGWWPCVADEGEKKILAGKLEM
TLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILWRRFRCAI
ILFIILFVLLLFVGIFLYSFPNYAAMKLVKPFS
Download sequence
Identical sequences M3Y7T8
XP_004742223.1.14098 ENSMPUP00000007395 ENSMPUP00000007395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]