SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007407 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007407
Domain Number 1 Region: 340-417
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.05e-20
Family Intermediate filament protein, coiled coil region 0.00067
Further Details:      
 
Domain Number 2 Region: 110-144
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000575
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007407
Domain Number - Region: 147-218
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00022
Family Intermediate filament protein, coiled coil region 0.0073
Further Details:      
 
Domain Number - Region: 228-340
Classification Level Classification E-value
Superfamily Prefoldin 0.00107
Family Prefoldin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007407   Gene: ENSMPUG00000007463   Transcript: ENSMPUT00000007527
Sequence length 493
Comment pep:novel scaffold:MusPutFur1.0:GL897098.1:2589718:2596596:1 gene:ENSMPUG00000007463 transcript:ENSMPUT00000007527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTCGFSTVGCGFGPRNFSCASACGPRPGRCCITAAPYRGVSCYRGLTGGFGSRSVCGGFR
AGSCGRSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKHEEKEQIKCLNS
RFAAFIDKVRFLEQQNKLLETKWQFYQNRKCCESNLEPLFEGYIETLRREAECVEADSGR
LASELNHVQEVMEGYKKKYEEEVALRATAENEFVALKKEVDCAYLRKSDLEANAEALTEE
IDFLRRLYEEEIRVLHAHISDTSVIVKMDNSRDLNMDCIVAEIKAQYDDIASRSRAEAES
WYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNTKLEAAVTQSEQ
QGETALSDARCKLAELEAALQKAKQDMACLVKEYQEVMNSKLGLDIEIATYRRLLEGEEQ
RLCEDVGAVNVCVSSSRGGVVCGDLCVSGSRPVTGSACSAPCSGNLAVSTGMCAPCGPLN
TTCGGGSCGLGRC
Download sequence
Identical sequences M3Y7V0
ENSMPUP00000007407 XP_004774747.1.14098 ENSMPUP00000007407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]