SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007412 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007412
Domain Number 1 Region: 286-506
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.22e-56
Family DBL homology domain (DH-domain) 0.0000674
Further Details:      
 
Domain Number 2 Region: 496-637
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-16
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 3 Region: 650-709
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000103
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007412   Gene: ENSMPUG00000007468   Transcript: ENSMPUT00000007532
Sequence length 730
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897035.1:4901225:4913846:-1 gene:ENSMPUG00000007468 transcript:ENSMPUT00000007532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDICMPPSPLCFCPRTRRPQSMSQRHSDSSLEEKLLEYRFHSELRLDARGNPAPGLPMVR
DSLQVRDNAAFQLDTSVPPPLSTKDEEPRTVVLSTQSPAALKMGTQQLIPRSLAVCSKAK
TPARHQSFGAAVLSKEAARREPRLVSAPSFSLDDMDVDTGPEGALRRNLRNQSYRAAMQG
LGAPGRERTPIQLSPKLQALAEESSPPPARCPAKNKRTLGRKRAHKGSFKDDPGFYQEIR
ERGLNTSHESDDDLLGEPSSPDGTGKAGAPIVVKSYRPAQVTWSQLPEVVESGLLDELSA
EERKRQEAIFEILTSEFSYQHSLGVLVAEFLQSRELRATMTQTEHHHLFSNILDVLSASQ
RFFEALEQRHKAQVCVEDISDILEEHAEKHFHPYVAYCSNEVYQQRALQKLTNSNAAFHE
ALKEIEKRPACGGLPMISFLILPMQRVTRLPLLTDTLCLKSQGHPERYKAASRALKAISK
LVQQCNEGARRMERTEQMYELHARLDFGRVKSLPLISASRWLLKRGELFVVEETRLFRKL
ASRPTCYLFLFNDVLVVTKKKSEDSFMVQDYAQVDHIRVQKMEPSDPGLLGGGGTRSSSV
PHPFQVTLLHNSEGLQEKILLSSDSASDRARWITALTHGERQGQGPTNKGDLPQVEITKA
YLARQADEITLQQADVVLVLEQEDGWVYGERLRDGETGWFPEDFARSITSRVAVEGNVRR
MERLRVETDV
Download sequence
Identical sequences M3Y7V5
ENSMPUP00000007412 ENSMPUP00000007412 XP_012920164.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]