SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007423 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007423
Domain Number 1 Region: 929-979
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.64e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 262-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000223
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 299-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000357
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 342-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000194
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 969-1016
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000173
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 6 Region: 61-189
Classification Level Classification E-value
Superfamily SET domain 0.000000687
Family Viral histone H3 Lysine 27 Methyltransferase 0.097
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007423
Domain Number - Region: 208-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00507
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Domain Number - Region: 404-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00664
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007423   Gene: ENSMPUG00000007479   Transcript: ENSMPUT00000007543
Sequence length 1158
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897035.1:4936451:5140129:-1 gene:ENSMPUG00000007479 transcript:ENSMPUT00000007543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHEPDPDLLAGESAEYETEDSVVSPIPMGPPSPFPTSEDFTPKEGSPYEAPVYIPEDIPI
PPDVELRESSIPGAGLGIWAKKRMEIGARFGPYMGAPRATWKEADFGWEHMLVDAEVSSQ
EGCIQKISEDLSTEKLCTDAGQAGSGSWLKYIRVACSCDDQNLTMCQINEQIYYKVIKDI
EPGEELLVHVKEGAYSLGTVPSSLDAEEPPFRCGACDELLQSKTDLRRHKKYACGSVGAP
LYEGLADELKPEGLSGGADGQAHECKDCERMFPNKYSLEQHMVVHTEEREYKCDQCPKAF
NWKSNLIRHQMSHDSGKRFECENCVKVFTDPSNLQRHIRSQHVGARAHACPDCGKTFATS
SGLKQHKHIHSTVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIRCKDCGQMFSTTSSL
NKHRRFCEGKNHYTPGGVFAPGLPLNPSPMMDKAKPPPGLNHAGLGFSEYFPSRPHPGSL
PFSAAPPAFPALAPGFPGIFPPSLYPRPPLLPPTPLLKSPLNHTQDAKLPSPLGNPALPL
VSAVGNSRQGATAATGPEDKLEHRLEDSYAEKLKARGSDVSDGSDFEDVNTTTGTDLDTT
TGTGSDLDSDVDSDPDKAKAKSEAAEGKPECGGGAAPPGAPNSAGEVPVFYSQHAFFPPP
DEQLLAAPGAAGDSIKAIASIAEKYFGPGFVGMQEKKLGSLPYHSVFPFQFLPNFPPALC
PFTDRSLTHNLLVKAEPRSPRDALKVGGPSAESPFDLTTKPKEAKPVLPVPKAPPAPASG
EEEPLDLSIGGRARAGQNGGGREPRKNHIYGERKLGAAAGLPRACPAQLPQQPILHYAKP
SPFFMDPIYSRVEKRKVADPVGVLKEKYLRPSPLLFHPQMSAIETMTDKLESFAAMKADS
GSSLQPLPHHPFNFRSPPPTLSDPILRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQP
YRCKYCDRSFSISSNLQRHVRNIHNKEKPFRCHLCNRCFGQQTNLDRHLKKHEHEHAPVS
QHSGVLTNHLGTSASSPTSESDNHALLDEKEDSYFSEIRNFIANSEMNQASTRTDKRPEA
QDLDGGSQCPGLASGKPEDVEEEEEEEEEEDDDSLAGKSQGDPVSPTPEPQGAYEDEEDE
EPPTSLAVGFEHTRRRMQ
Download sequence
Identical sequences M3Y7W6
ENSMPUP00000007423 ENSMPUP00000007423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]