SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007438 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007438
Domain Number 1 Region: 497-866
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.79e-126
Family Hect, E3 ligase catalytic domain 0.00000000000853
Further Details:      
 
Domain Number 2 Region: 400-440
Classification Level Classification E-value
Superfamily WW domain 9.6e-16
Family WW domain 0.00051
Further Details:      
 
Domain Number 3 Region: 18-139
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000213
Family PLC-like (P variant) 0.0017
Further Details:      
 
Domain Number 4 Region: 332-365
Classification Level Classification E-value
Superfamily WW domain 0.00000000000178
Family WW domain 0.0013
Further Details:      
 
Domain Number 5 Region: 296-332
Classification Level Classification E-value
Superfamily WW domain 0.00000000000473
Family WW domain 0.0015
Further Details:      
 
Domain Number 6 Region: 442-477
Classification Level Classification E-value
Superfamily WW domain 0.0000000000148
Family WW domain 0.00056
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007438
Domain Number - Region: 350-396
Classification Level Classification E-value
Superfamily IpaD-like 0.0863
Family IpaD-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007438   Gene: ENSMPUG00000007494   Transcript: ENSMPUT00000007558
Sequence length 872
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896910.1:20367983:20491592:1 gene:ENSMPUG00000007494 transcript:ENSMPUT00000007558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSFVEVAVDGLPSETKKTGKRI
GSSELLWNEIIILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENTQLT
LNLQTENKGGVVSGGELTIFLDGPTVDLGSVPTRLMFRVRGSQPPSRESSGTAVAPENRH
QPPSTNCFGGRSRTHRHSGGSARTAPATGEQSPGTSNRHRQPVKNPTHNGLANGTVNDEP
TAATDPEEPSVVGVTSSPAAVSSVTPNPTSVSLPASATPAEGEEPSTSGTQQLPAAAQAL
DALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRTTTWQ
RPTAEYVRNYEQWQSQRNQLQGAMQHFSQRFLYQSSSTSTDHDPLGPLPPGWEKRQDNGR
VYYVNHNTRTTQWEDPRTQGMIQEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGF
ESGTKQGSPGAYDRSFRWKYHQFRFLCHSNALPSHVKISVSRQTLFEDSFQQIMNMKPYD
LRRRLYIIMRGEEGLDYGGIAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASSINP
DHLTYFRFIGRFIAMALYHGKFIDTGFTLPFYKRMLNKRPRQLQNSLHASGRGPVQLLWI
KENNLEECGLELYFIQDMEILGKVTTHELKEGGESIRVTEENKDEYIMLLTDWRFTRGVE
EQTKAFLDGFNEVAPLEWLRYFDEKELELMLCGMQEIDMSDWQKNTIYRHYTKNSKQIQW
FWQVVKEMDNEKRIRLLQFVTGTCRLPVGGFAELIGSNGPQKFCIDRVGKETWLPRSHTC
FNRLDLPPYKSYEQLKEKLLYAIEETEGFGQE
Download sequence
Identical sequences M3Y7Y1
ENSMPUP00000007438 ENSMPUP00000007438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]