SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007464 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007464
Domain Number 1 Region: 4-492
Classification Level Classification E-value
Superfamily SIS domain 1.33e-202
Family Phosphoglucose isomerase, PGI 0.0000000000000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007464   Gene: ENSMPUG00000007520   Transcript: ENSMPUT00000007584
Sequence length 508
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897008.1:2327438:2353481:-1 gene:ENSMPUG00000007520 transcript:ENSMPUT00000007584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALTQNPQFQKLQKWYREHGSDLNLRRLFEGDKERFSHFSLNLNTSHGHILVDYSKNLV
TDTVMQMLVDLAKSRGVEAARDRMFSGEKINFTEERAVLHVALRNRSNTPILVDGKDVMP
EVNRVLEKMKSFCQRVRSGEWKGYSGKPITDVINIGIGGSDLGPLMVTEALKPYSSGGPR
VWFVSNIDGTHIAKTLATLNPESSLFIIASKTFTTQETITNAETAKEWFLLSAKDPSAVA
KHFVALSTNTSKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGA
HWMDQHFRTTPLEKNAPVILAMLGIWYINCFGCETQAMLPYDQYLHRFAAYFQQGDMESN
GKYITKSGTRVDHQTGPILWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGL
HHKILLANFLAQTEALMKGKSTEEARKELQAAGTSPEALEKLLPHKVFEGNRPTNSIVFT
KLTPFILGALIXXXXXXXXXXXXXXXXX
Download sequence
Identical sequences M3Y807
ENSMPUP00000007464 ENSMPUP00000007464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]