SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007497 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007497
Domain Number 1 Region: 1212-1578
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.44e-122
Family Hect, E3 ligase catalytic domain 0.00000000945
Further Details:      
 
Domain Number 2 Region: 984-1026
Classification Level Classification E-value
Superfamily WW domain 0.0000000000282
Family WW domain 0.0013
Further Details:      
 
Domain Number 3 Region: 191-292
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000156
Family Synaptotagmin-like (S variant) 0.049
Further Details:      
 
Domain Number 4 Region: 819-848
Classification Level Classification E-value
Superfamily WW domain 0.0000000193
Family WW domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007497   Gene: ENSMPUG00000007553   Transcript: ENSMPUT00000007617
Sequence length 1584
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897069.1:661883:885204:-1 gene:ENSMPUG00000007553 transcript:ENSMPUT00000007617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSAREHLLFVRRRNPQMRYTLSPENLQSLAAQSSMPENMTLQRANSDTDLVTSESRSS
LTASMYEYTLGQAQNLIIFWDIKEEVDPSDWIGLYHIDENSPANFWDSKNRGVTGTQKGQ
IVWRIEPGPYFMEPEIKICFKYYHGISGALRATTPCITVKNPAVMMGAEGMEGGASGNQH
SRKLVSFTLSDLRAVGLKKGMFFNPDPYLKMSIQPGKKSSFPTCAHHGQERRSTIISNTT
NPIWHREKYSFFALLTDVLEIEIKDKFAKSRPIIKRFLGKLTIPVQRLLERQAIGDQMLS
YNLGRRLPADHVSGYLQFKVEVTSSAHEDASPEAVGTILGVNTVNGDLGSPSDEEDMSGG
HHDGPVCSNGPVSEDSAADGTPKHSFRTSSTLEMDTEELTSTSSRTSPPRGRQDSLNDYL
DAIEHSSHSRPGPASCSERSMGASPKLRSSFPTDTRLNAMLHIDSDEEDHEFQQDLGYPS
SLEEEGGLIMFGATSRTDDASLTSQTKPEDPPAEAEAEDASTNDAASLEEKPEHPPEPAE
ASLPAGPAPEESLLGRETERQRETERGGDRQTDRQTWSRMYVSSGSQANGHQPLRSLPSV
RQDVSRYQRVDEALPPSKPLLARRGMLKGAPQVLSTGPEGGCRLPERTGPQGCPLTEQQQ
ALSSRCFGPSCSQFPISTSLVTEQQSSGICAALSLLKHPLKFSAHHACVHGLMSSPAGRS
SGDQDALCPDCTPHFTIWQDNVLGSTKTDLSTPSPPLRQPLPTRLYHSEPSNPENCVRIR
ALVSAGANAIGGQQPTRLPPSVQGHADPWCLSISCVMTYWEARIDSHGRIFYVDHVNRTT
TWQRPTAPPAPQVLQRSNSIQQMEQLNRRYQSIRRTMTNERPEENTTAIDGAAEEADFHP
ASADFRRESVLPHSTSRSRLTLLLQSPPVKFLISPEFFTVLHSNPSAYRMFTNNTCLKHM
ITKVRRDTHHFERYQHNRDLVGFLNMFANKQLELPRGWEMKHDHQGKAFFVDHNSRTTTF
IDPRLPLQSSRPSALVHRQHLTRQRSHSAGEVGEDSRHTGPPVLPRPSSTFNTVSRPQYQ
DMVPVAYNDKIVAFLRQPNIFEILQERQPDLTRNHSLSLNREKIQFIRTEGTPGLVRLSS
DADLVMLLSLFEEEIMSYVPPHALLHPSYCQSPRGSPVSSPQNSPGTQRANARAPAPYKR
DFEAKLRNFYRKLETKGYGQGPGKLKLIIRRDHLLEDAFNQIMGYSRKDLQRNKLYVTFV
GEEGLDYSGPSREFFFLVSRELFNPYYGLFEYSANDTYTVQISPMSAFVDNHHEWFRFSG
RILGLALIHQYLLDAFFTRPFYKALLRILCDLSDLEYLDEEFHQSLQWMKDNDIHDILDL
TFTVNEEVFGQITERELKPGGANIPVTEKNKKEYIERMVKWRIERGVVQQTESLVRGFYE
VVDARLVSVFDARELELVIAGTAEIDLSDWRNNTEYRGGSIGYHDNHIVIRWFWAAVERF
NNEQRLRLLQFVTGTSSIPYEGFASLRGSNGPRRFCVEKWGKITALPRAHTCFNRLDLPP
YPSFSMLYEKLLTAVEETSTFGLE
Download sequence
Identical sequences M3Y840
ENSMPUP00000007497 ENSMPUP00000007497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]