SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007523 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007523
Domain Number 1 Region: 21-185
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.03e-22
Family Synaptotagmin-like (S variant) 0.069
Further Details:      
 
Domain Number 2 Region: 1273-1305
Classification Level Classification E-value
Superfamily Eferin C-derminal domain-like 0.000000000157
Family Eferin C-derminal domain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007523   Gene: ENSMPUG00000007579   Transcript: ENSMPUT00000007644
Sequence length 1308
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896905.1:14567037:14601554:-1 gene:ENSMPUG00000007579 transcript:ENSMPUT00000007644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKSSGAGSTSDAYTVIQVGREKYSTSVV
EKTPGCPEWREECSFELPPGALDGLLRAQEADAGPAPWAAGSAAACELVLTTMHRSLIGV
DKFLGQATVALDEVFGAGRAQHTQWYKLHSKAGKKEKERGEIQVTIQFTRNNLSASMFDL
SMKDKPRSPFSKIKDKMKGKKKFELESASAILPSSALEDPELGSLGKMGKAKGFFLRNKL
RKSSLTQSSTSLGSDSTLSSASGSLAYQGPGAELLTRSPSRSSWLSSEGGRDATQSPKLL
THKRTYSDEASQMRATPPRSLLDLQGHLETASRSSLCVNGSHIYNEEPQALPRHRSSISG
PFPPSGSLHSVSSRPTEEGARPADDSGGRGSRRTSISEVLLGQEELSSRAKVLVPGTSRS
GEEEGARLPEGKPVQVATPMVASSEAVAEKEGARKEERKPRMGLFHHHHQGLSRSELGRR
GSLGEKGGPTLGASPHHPSSGEEKAKSSWFGLREAKEPTQKPSLDVSPQVEPDPAALPHH
LPCSPCAPALPTPPPTAAPMLSTNLFAAASPAAAAATAAASAAPEATPSGFSGLTNPFLT
SMQSNPFFEELLADIALNCPSPAPSLPSASRPSPTPLASPGKAPPEWDDTFNVFAASRLR
PEARSKILAPAGGVGLEVTGPQEQGRGAVTVKVAEPQGAPGGGGRGGSNVWLEPRLPLDL
GLNRRSSSVAELGPLGPAGASLPSSSAQLQPRAADSKADREPPAPGGDAGQSPADSATSL
FSSPEVISVWERLPGPDDAPEVQEAASGGKGQLLHELNTVDDSWPWDMLTISPIAETSSP
VLRGESDEKMQPESLEPVSPGGSKGPVPQEPEHKPKPVSDREPQPGRPPPKPPRLFTPSE
SQEKEEEVAVAAAAAGGLRSRGAETGGEDSLPSPLVAGPREAKEEGQTPGAESDSHSSGT
LPCGPGLQDKAEGAGPPVPQLPLSPPTSCPEGPTPVPCYSESVAPQSLQIWGAPEKGESP
EGPEARRQGPVEEGLGPLLDSSQHTDVWASEEDALNPFLSQESQDPPSLPSISPPGSREP
SILSGPEELPTPPEPAFPPPPLPSWAGHHHGGPSPPCSPLPGAQPLTSSSPTLGEPASSP
GGSPAPPGEDHAATTPASPLVLLPLETRPAEEPQSSASPHPVKPLSAAPVEGSPDRKQPR
SSLSTALSSGLEKLKTVTSGGIQPVAPAPHVGQTVDTKRLKDSGVLDQSAKYYHLTHDEL
IGLLLQRERELSQRDEHVQELESYIDRLLVRIMETSPTLLQIPPDPPK
Download sequence
Identical sequences M3Y866
ENSMPUP00000007523 ENSMPUP00000007523 XP_004742249.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]