SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007538 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007538
Domain Number 1 Region: 188-256
Classification Level Classification E-value
Superfamily Leucine zipper domain 1.25e-21
Family Leucine zipper domain 0.0000427
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007538   Gene: ENSMPUG00000007593   Transcript: ENSMPUT00000007659
Sequence length 268
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897008.1:3254966:3256072:1 gene:ENSMPUG00000007593 transcript:ENSMPUT00000007659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGSAQPPAPPAAPEPLGGICEHET
SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAAPAGAAGGDFDYTGAPGGPGGSVMP
GGAHGPPPGYGCAAAGYLDGRLEPPHPAPALGPAGLPGPGGALKGLAATHPDLRAGGGGS
AGKVKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQ
LSRELDTLRGIFRQLPESSLVKAMGNCA
Download sequence
Identical sequences M3Y881
ENSMPUP00000007538 ENSMPUP00000007538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]