SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007558 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007558
Domain Number 1 Region: 424-645
Classification Level Classification E-value
Superfamily TPR-like 6.07e-33
Family Tetratricopeptide repeat (TPR) 0.0023
Further Details:      
 
Domain Number 2 Region: 660-801
Classification Level Classification E-value
Superfamily TPR-like 4.1e-22
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007558
Domain Number - Region: 180-243
Classification Level Classification E-value
Superfamily SIS domain 0.0452
Family mono-SIS domain 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007558   Gene: ENSMPUG00000007613   Transcript: ENSMPUT00000007679
Sequence length 916
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896921.1:12071664:12116237:-1 gene:ENSMPUG00000007613 transcript:ENSMPUT00000007679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADINLKEITLIVGVVTACYWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTP
MSEERSHKSYRPLTVLTFRLNYLFSELKPMSYHLLNMIFHAVVSVIFLKVCKLFLDNKSS
MIASLLFAVHPIHTEAVTGVVGRAELLSSIFFLAAFLSYTRSKGPDNSIVWTPIALTVVL
VAVATLCKEQGITVVGICCVYEVFIAQGYTLPLLWTTAGQFFRGKSSIPFSMLQTLIKLI
VLMFSTLLLVVIRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPLNAWLLLNPSEL
CCDWTMGTIPLIESFLDIRNLATFTFFCFLGALGIFSLRYPGDSSKTVLMALCLMALPFI
PASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQKISNKSVLKKLSWICLSMVIFTHALK
TLHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFERALKYFLQATHVQPDDI
GAHMNVGRTYKNLNRTKEAEESYMMAKSLMPQIIPGKKYAARIAPNHLNVYINLANLIRA
NESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLW
YNLAIVHIELKEPNEALKNFNRALELNPKHKLALFNSAILMQESGEVKLRPEARKRLLSY
INEEPQDANGYFNLGMLAMDDKKDSEAEMWMKKAIKLQADFRSALFNLALLYSQTAKELM
ALPILEELLRHYPDHIKGLILKGDILMNQKKDILGAKKCFEKILEMDPSNVQGKHNLCVV
YFEEKDLLKAERCLVETLALAPHEEYIQRHLNIVRDKISSSSFAEQPISPAGKTSGVEGD
KIPTENVQEDVKSEPRSTQIIKPSDNKSQSKSNKLLGKNTDKETPHKTTKEIKEIEKKRV
AALKRLEEIERILNGE
Download sequence
Identical sequences M3Y8A1
ENSMPUP00000007558 ENSMPUP00000007558 XP_004748637.1.14098 XP_012909670.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]