SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007575 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007575
Domain Number 1 Region: 128-199
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-21
Family SH3-domain 0.00066
Further Details:      
 
Domain Number 2 Region: 440-519
Classification Level Classification E-value
Superfamily SH3-domain 1.18e-20
Family SH3-domain 0.00086
Further Details:      
 
Domain Number 3 Region: 793-879
Classification Level Classification E-value
Superfamily SH3-domain 4.33e-18
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 4 Region: 194-263
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000125
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 5 Region: 10-67
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000132
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007575   Gene: ENSMPUG00000007630   Transcript: ENSMPUT00000007696
Sequence length 880
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896960.1:9439346:9615512:1 gene:ENSMPUG00000007630 transcript:ENSMPUT00000007696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDESSLLDLLECPVCLERLDASAKVLPCQHTFCKRCLLGIVGSRNELRCPECRTLVGSGV
EELPSNILLVRLLDGIKQRPWKPGPGGGSGTNCTNALRAQSNTVANCSSKDLQSSQGGQQ
PRVQAWSPPVRGIPQLPCAKALYNYEGKEPGDLKFSKGDIIILRRQVDENWYHGEVNGIH
GFFPTNFVQIIKPLPQPPPQCKALYDFEVKDKEADKDCLPFAKDDVLTVIRRVDENWAEG
MLADKIGIFPISYVEFNSTAKQLIEWDKPPVPGVDAGECTSAAAQSSNAPKHSDTKKNTK
KRHSFTSLTMASKSSQASQNRHSMEISPPVLISSSNPTAAARISELSGLSCSAPSQVHIS
TTGLIVTPPPSSPVTTGPSFTFPSDVPYPAALGTMNPPLPPPPLLASTPPGAATTVAAAA
AAGMGPRPTAGPSDQIAHLRPQTRPSVYVAIYPYTPRKEDELELRKGEMFLVFERCQDGW
FKGTSMHTSKIGVFPGNYVAPVTRTVTNASQAKVPMSTAGQTSRGVTIVSPSTAGGPTQK
LQGNGMAGSPSVVPTAVVSAAHIQTSPQAKVFLHMTGQMTVNQARSAVRTVAAHNQERPT
AAVTPIQVQNTACLGAASVGLPHHPLASPQLPSPMGGPATHMAAINMGRVSAPLACAAAA
SLTSANITTASLESEPVGRAVTILPGLPTSPDSASLACGNSSATKPDKDNKKEKKGLLKL
LSGASTKRKPRASPPASPTLEVELGGCELPLQGAVGPELPLGGAHGRAGSCPTDGEGPAA
FVAQDALHRKTSSLDSAVPIAPPPRQPCSSLGPVMNESRPLVCERHRVVVSYPPQSEAEL
ELKEGDIVFVHKKREDGWFKGTLQRNGKTGLFPGSFVENI
Download sequence
Identical sequences M3Y8B8
XP_004758169.1.14098 XP_004758170.1.14098 XP_012914636.1.14098 ENSMPUP00000007575 ENSMPUP00000007575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]