SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007610 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007610
Domain Number 1 Region: 311-478,561-729
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 3.25e-125
Family Mammalian PLC 0.000000724
Further Details:      
 
Domain Number 2 Region: 153-310
Classification Level Classification E-value
Superfamily EF-hand 7.35e-42
Family EF-hand modules in multidomain proteins 0.053
Further Details:      
 
Domain Number 3 Region: 747-863
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.89e-28
Family PLC-like (P variant) 0.00063
Further Details:      
 
Domain Number 4 Region: 27-139
Classification Level Classification E-value
Superfamily PH domain-like 3.35e-26
Family Pleckstrin-homology domain (PH domain) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007610   Gene: ENSMPUG00000007665   Transcript: ENSMPUT00000007731
Sequence length 1130
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897035.1:5560826:5624936:-1 gene:ENSMPUG00000007665 transcript:ENSMPUT00000007731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPPGDPGPNLRTGQSFLNINILPVVERCMSAMQAGTQMVKLRGGSKGLVRFYFLDEHR
SCVRWRPSRKHEKAKISIDSIQEVSEGRQSEVFQRYPDGVFDPNCCFSIYHGSHRESLDL
VSPSGDEARTWVTGLRYLMAGISDEDSLARRQRTRDQWLKQTFDEADKNGDGSLSIGEVL
QLLHKLNVNLPRQKVKQMFKEADTDDHQGTLGFEEFCAFYKMMSTRRDLYLLMLTYSDHK
DHLDVTDLQRFLEVEQKVVGVTLESCRDIVQQFEPCPENKTKGVLGIDGFTNYTRSPAGD
IFNPEHHGVHQDMTRPLSHYFITASHNTYLVGDQLLSQSRVDMYAWVLQAGCRCVEVDCW
DGPDGEPIVHHGYTLTSKILFKDVIETINKYAFVKNEYPVILSIENHCSVIQQKKMARYL
TDILGDKLDLSSVSGEDATVLPSPQMLKGKILVKGKKLPAGISEDAEEGEVSDEDSADEM
DEDCKLLNGDVATNRKRVENIAKKKLDSLMKESKIRDCEDPNDFTVSTLPPSGKLGHKAE
GKKAEEDVESGEDAGASRRNNRILMSGFSKRKKKASKLKKVASVEEGDEDLDSQGSQSRG
AARQKKTMKLSRALSDLVKYTKSVGMRDVEAEVASSWQVSSFSETRAQQILQQKPAQYLR
FNQHQLSRIYPSPYRVDSSNYNPQPFWNAGCQMVALNYQSEGRMLQLNRAKFSANGNCGY
VLKPECMCQGVFNPNSEDPLPGQLKKQLVLRIISGQQLPKPRDSMLGDRGEIIDPFVEVE
VIGLPVDCNKEQTRVVDDNGFNPMWEETLVFTVHMPEIALVRFLVWDHDPIGRDFIGQRT
LAFSSMMPGYRHVYLEGMEEASIFVHVAVSDISGKVKQALGLKGLFLRGPKPGSLDSHAA
GRPPPRPSVSQRLLRRTASAPTKSQKPGRKAFPELVLGTQDTGSEGEVRDVAAPSPGPTL
EAPAPEEPGSRSPRGKAPVGKSPMPQNLGQEPPPCAPEGPGPAGMAATCMKCVVGSCAGE
DAEGLRRGRLPSPGSPATHEAISQQPRARADSLGAPCAGPGRGRGALRQGPGGGSVSTDS
SGLGSPEVFPHWPEGARRQAGALQREMNALFVQKLEEIRSNSSMLSTVRD
Download sequence
Identical sequences M3Y8F3
ENSMPUP00000007610 ENSMPUP00000007610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]