SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007646 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007646
Domain Number 1 Region: 338-596
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-65
Family Nuclear receptor ligand-binding domain 0.000000000988
Further Details:      
 
Domain Number 2 Region: 266-343
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.76e-28
Family Nuclear receptor 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007646   Gene: ENSMPUG00000007702   Transcript: ENSMPUT00000007768
Sequence length 598
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897098.1:2795944:2801265:-1 gene:ENSMPUG00000007702 transcript:ENSMPUT00000007768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCIQAQYGTPAPSPGPRDHLASDPLTTELSKPTMDLASPEAAPTAPTALPSFSTFMDGY
TGEFDTFLYQLPGTAPPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSTPL
DETLSSSGSDYYGSPCSAPSPSTPSFQPSQLSPWDGSFGPFSPSQTYEGLRAWTEQLPKA
AGHAQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATCQLGERESYSISTAFPGLAPTSPHL
DGPGMLDTPLPSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAK
YICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDAS
PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKW
AEKIPGFAELSPSDQDLLLESAFLELFILRLAYRSKPAEGKLIFCSGLVLHRLQCARGFG
DWIDSILAFSRSLHSLVVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVS
TAAGEPQPASCLSRLLGKLPELRTLGTQGLQRIFYLKLEDLVPPPPIVDKIFMDTLPF
Download sequence
Identical sequences M3Y8I9
ENSMPUP00000007646 XP_004774758.1.14098 XP_004774761.1.14098 XP_004774763.1.14098 XP_012902372.1.14098 ENSMPUP00000007646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]