SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007648 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007648
Domain Number 1 Region: 240-376
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.42e-40
Family Synaptotagmin-like (S variant) 0.00000198
Further Details:      
 
Domain Number 2 Region: 103-234
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.98e-40
Family Synaptotagmin-like (S variant) 0.0000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007648   Gene: ENSMPUG00000007704   Transcript: ENSMPUT00000007770
Sequence length 386
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897135.1:2205161:2210111:1 gene:ENSMPUG00000007704 transcript:ENSMPUT00000007770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSEPPTPEPPAPDAPPDSSRIGPAPVPLWALAAIVLVSGLLVFGCCFCVYRKRCRRRLG
KKSQAQAQVHLQEVKELGRSYIDKVQPEVEELEPAPSGPGSQVAEKHELGRLQYSLDYDF
QSGQLLVGIVQAEGLAALDLGGSSDPYVRVYLLPDKRRRHETKVHRQTLNPHFGENFAFK
VPYVELGGRVLVMAVYDFDRFSRNDAIGEVRVPMSSVDLGRPVLAWRELQAAPREEQEKL
GDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKN
TLNPYYNEAFSFEVPCDQVQKVQVELTVLDYDKLGKNEAIGRVAVGAAVGGAGLRHWADM
LANPRRPIAQWHSLRPPDRVRPLPAP
Download sequence
Identical sequences M3Y8J1
XP_004777102.1.14098 ENSMPUP00000007648 ENSMPUP00000007648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]