SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007658 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007658
Domain Number 1 Region: 95-193
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-19
Family PDZ domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007658   Gene: ENSMPUG00000007714   Transcript: ENSMPUT00000007780
Sequence length 314
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897098.1:2839239:2847064:-1 gene:ENSMPUG00000007714 transcript:ENSMPUT00000007780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRRLRKLQQKEEAAAAPDPAARAPDSEVAPSTPAPTPASGPRAAAASSGAPGDDLYAA
LEDYHPAELYRALAVSGGTLPRRKGSGFRWKNLGQSPEQQRKVLTLEKEENQTFGFEIQT
YGLHHREEQRVEMVTFVCRVHESSPAQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKAS
GNVLRLETLYGTSIRKAELEARLQYLKQTLYEKWGEYRSLMVQEQRLVHGLVVKDPSIYD
TLESVRSCLYGAGLLPGSLPFGPXGAPGALWTEAREQALCGPGLRKAKYRSFRRRLLKFI
PGLNRSLEEEESQL
Download sequence
Identical sequences M3Y8K1
ENSMPUP00000007658 ENSMPUP00000007658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]