SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007687 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000007687
Domain Number - Region: 17-56
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 0.00615
Family Rap/Ran-GAP 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007687   Gene: ENSMPUG00000007744   Transcript: ENSMPUT00000007810
Sequence length 87
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896911.1:7534641:7542367:1 gene:ENSMPUG00000007744 transcript:ENSMPUT00000007810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSVLRLTIVLGLLALILTCQAGILYDKPDDKPEGSDKNPEPEFPKFLNILGTEIIENA
VEFILRSMTRSTEFMEFDDKQGEHSAK
Download sequence
Identical sequences M3Y8N0
ENSMPUP00000007687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]