SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007739 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007739
Domain Number 1 Region: 355-488
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000179
Family Synaptotagmin-like (S variant) 0.0039
Further Details:      
 
Domain Number 2 Region: 219-349
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000172
Family Synaptotagmin-like (S variant) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007739   Gene: ENSMPUG00000007796   Transcript: ENSMPUT00000007863
Sequence length 490
Comment pep:known scaffold:MusPutFur1.0:GL896900.1:23438250:23463431:1 gene:ENSMPUG00000007796 transcript:ENSMPUT00000007863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEFIKSCCRGCFYGGTEKHNFSRERDFQAAVSETQDTPVSVPPLTAVSVKPQVGCTED
YLLSKLPSDGKDVPFVVPRFKLSYVQPRVPGTLSHLEELEGSARASFGDRKVELSSSSQH
GPGYDIYNPCYRYPHISPDLNRRLPPRSEAVRLYGSVCDLRTSKLPSSPGLSKSMFDLTS
SSQRFMQRHDSWSSMPSTSSSRKNSQGSNRSLDTITLSGDERDFGRLNVKVFYNSSVEQI
WITVLQCRDLSWPSNCGDTPTISIKGTLTLPKPVHFKSSAKDGSHIIEFMETFVFAIKLQ
SLQTVRLVFKIQTRTPRKKTIGECSLSLRTLSTQEMEYSLDIMPPSKISVCHAELELGTC
FQAVNSRIQLQILEAQYLPNSSTPLALSFFVKVGMFSSGELIYKKKTRLLKASNGRVKWG
ETMIFPLIQNEKEILFLIKLYSRSSVRRRHFVGQIWISEDSNHTEAANQWKETVTNPEKV
VIKWHKLNPS
Download sequence
Identical sequences G9KSP9
XP_012913045.1.14098 ENSMPUP00000007739 ENSMPUP00000007739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]