SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007758 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007758
Domain Number 1 Region: 21-117
Classification Level Classification E-value
Superfamily RING/U-box 1.67e-48
Family RING finger domain, C3HC4 0.00000259
Further Details:      
 
Domain Number 2 Region: 413-530
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.55e-37
Family Ankyrin repeat 0.00019
Further Details:      
 
Domain Number 3 Region: 561-661
Classification Level Classification E-value
Superfamily BRCT domain 1.89e-21
Family BRCT domain 0.01
Further Details:      
 
Domain Number 4 Region: 607-766
Classification Level Classification E-value
Superfamily BRCT domain 9.95e-19
Family DNA topoisomerase II binding protein 1, TopBP1 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007758   Gene: ENSMPUG00000007816   Transcript: ENSMPUT00000007883
Sequence length 767
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897025.1:1022672:1106771:1 gene:ENSMPUG00000007816 transcript:ENSMPUT00000007883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGNRQPRVRSGNEPGPAPSMEPEGRGAWAHSRGALDRLEKLLRCSRCTHILREPVCLGG
CEHIFCSNCVSDCIGTGCPVCYTPAWIQDVKINRQLDSMIQLCSKLRNLLHDDKLSDLEE
DTSRGNLFNDAENKKNSIKMWFSPRSKKVRYVVSKVSVQTQPQVINDEGARQASMYEFVS
ASPPTSVCERAKKASTRSRKKQKKKTLAEINQEWNLEAEREDGELDSKEELKEKLVSFCS
QPSVIASPRTNGEIDLLASGSVAESQGCGSFTEVSLPLAEHIDSPEAEGRSEDVTPEKKL
CENPRASGPSGRRGRRSGPSSPVPKRCRSSIPGTSRQRIVLADNKPLPGCSLPPSSKLKA
GDTLRRKNSNASDESTSLSPGTPLSALNSPSYRRMMSSPSAAKLSPTSLLAVKRNHRGET
LLHIASIKGDIPSVEYLLQNGSDPNVKDHAGWTPLHEACNHGHLKVVELLLQHKALVNTT
GYQNDSPLHDAAKNGHLDIVKLLLSYGASRNAVNIFGLRPVDYADGENMKSLLLLPEKND
SSSTRHCSVMNTGQRRDGPLVLIGSGLSSEQQKMLSELAAILKAKKCAEFDNTVTHVIVP
GDTVQSTLKCMLGILNGCWILKFEWVKACLQRKACEREEKYEIPEGPQRSRLNKEQLLPK
LFDGCYFYFGGTFKYHPKDNLIKLVAAAGGQVLSRKPKPDSDVTQTINTVAYHARPDSDQ
RFCTQYIIYEDLSNHRPERVRQGKVWMAPSSWFIDCVMSFELLPLDS
Download sequence
Identical sequences M3Y8V1
ENSMPUP00000007758 XP_004767063.1.14098 ENSMPUP00000007758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]