SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007759 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007759
Domain Number 1 Region: 769-832
Classification Level Classification E-value
Superfamily FF domain 1.44e-16
Family FF domain 0.0000214
Further Details:      
 
Domain Number 2 Region: 639-704
Classification Level Classification E-value
Superfamily FF domain 8.5e-16
Family FF domain 0.0000173
Further Details:      
 
Domain Number 3 Region: 702-764
Classification Level Classification E-value
Superfamily FF domain 0.00000000000000406
Family FF domain 0.0033
Further Details:      
 
Domain Number 4 Region: 874-945
Classification Level Classification E-value
Superfamily FF domain 0.00000000000000981
Family FF domain 0.0000104
Further Details:      
 
Domain Number 5 Region: 940-997
Classification Level Classification E-value
Superfamily FF domain 0.0000000000392
Family FF domain 0.0043
Further Details:      
 
Domain Number 6 Region: 420-452
Classification Level Classification E-value
Superfamily WW domain 0.000000000415
Family WW domain 0.00032
Further Details:      
 
Domain Number 7 Region: 136-168
Classification Level Classification E-value
Superfamily WW domain 0.000000000623
Family WW domain 0.0011
Further Details:      
 
Domain Number 8 Region: 509-547
Classification Level Classification E-value
Superfamily WW domain 0.0000000668
Family WW domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007759   Gene: ENSMPUG00000007817   Transcript: ENSMPUT00000007884
Sequence length 1018
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896911.1:8801900:8862598:-1 gene:ENSMPUG00000007817 transcript:ENSMPUT00000007884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERGGDGGDGERFNPGELRMAQQQALRFRGPAPPPNAVMRGPPPLMRPPPPFGMMRGPP
PPPRPPFGRPPFDPNMPPMPPPGGIPPPMGPPHLQRPPFMPPPMGTMPPPPGMMFPPGMP
PVTAPGTPALPPTEEIWVENKTPDGKVYYYNARTRESAWTKPDGVKVIQQSELTPMLAAQ
AQVQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQVQAQVQAQ
AVGASTPTTSSPAPAVSTSTSSSTPSSTTSTTTTASSVSQTVSTPTTQDQTPSSAVSVAT
PTVSVSTPAPTATPVQTVPQPHPQTLPPAVPHSVPQPAAAIPAFPPVMVPPFRVPLPGMP
IPLPGVAMMQIVSCPYVKTVATTKTGVLPGMAPPIVPMIHPQVAIAASPATLAGATAVSE
WTEYKTADGKTYYYNNRTLESTWEKPQELKEKEKLEEKIKEPIKEPSEEPLPMETEEEDP
KEEPIKEIKEEPKEEEMTEEEKAAQKAKPVATTPIPGTPWCVVWTGDERVFFYNPTTRLS
MWDRPDDLIGRADVDKIIQEPPHKKGMEEVKKLRHPTPTMLSIQKWQFSMSAIKEEQELM
EELNEDEPVKAKKRKRDDNKDIDSEKEAAMEAEIKAARERAIVPLEARMKQFKDMLLERG
VSAFSTWEKELHKIVFDPRYLLLNPKERKQVFDQYVKTRAEEERREKKNKIMQAKEDFKK
MMEEAKFNPRATFSEFAAKHAKDSRFKAIEKMKDREALFNEFVAAARKKEKEDSKTRGEK
IKSDFFELLSNHHLDSQSRWSKVKDKVESDPRYKAVDSSSMREDLFKQYIEKIAKNLDSE
KEKELERQARIEASLREREREVQKARSEQTKEIDREREQHKREEAIQNFKALLSDMVRSS
DVSWSDTRRTLRKDHRWESGSLLEREEKEKLFNEHIEALTKKKREHFRQLLDETSAITLT
STWKEVKKIIKEDPRCIKFSSSDRKKQREFEEYIRDKYITAKADFRTLLKETKFITYS
Download sequence
Identical sequences M3Y8V2
ENSMPUP00000007759 ENSMPUP00000007759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]