SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007767 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007767
Domain Number 1 Region: 980-1107
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-21
Family Pleckstrin-homology domain (PH domain) 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007767   Gene: ENSMPUG00000007825   Transcript: ENSMPUT00000007892
Sequence length 1124
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896904.1:29165343:29212786:-1 gene:ENSMPUG00000007825 transcript:ENSMPUT00000007892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFTEKLLERTRARRENLQRKMAERPTAAARSMTHAKRAREPLSEASNQQPLPGSEEKS
CTKPSPSKKRCSDTTEVAEVSNLENEKPVESASAKPCPPSPPAPQAQPQAPAPVSASETA
PAPVPRVRRGLNSRLESTAGSSVKTRMQKLAEQRRHWDNNDLTDDIPESSVISPMPSEEK
AASPPKPALSDASATPVGRRGRLANLAATICSWEDDVNYSSAKQHSAQEQPGTTCLSKFS
SASGASARINSSSVKQEATCCSQRDGEASLNKAPSSSAVGVSLNNAAISSSVKAASSPVK
SSTTAITDAKNCNGQNPELLQKTPVSPLKTEISKPIEKSTVSQTFRPKEELNRETCRQSQ
SKDKAATSGGAGIKPFLERFGERCQEHSKQSPARSTPHRTPVITPNTRAIQERLFQQNTS
SSTTHLAQQLKQEREKELACLRGRFDKGNLWSAEKGETSRSKQLETKQEIHCQNTPLKKH
PAVSNTPSVPVTEKVTENQTPGKPSNTEPTGFTECEMTKSSPLKITLFLEEDKSLKVTSE
PKVEQQTEVVRETEMSVDDDDDINSSKVINDIFSDVLVEGELDMEKSEEEMDHEEQEDAL
NISSMSLLAPLAQTVGVVSPESLVSSPRLELKDSSVSDESPKPGKFQRTRVPRAESGDSI
GSEDRDLLYSIDAYRSQRFKETERPSIKQVIVRKEDVTSKLDEKKNGFPGQVNIKQKMQE
LNNEINLQQTVIYQASQALNCCVDEDHGKGSLEEAEAERLLLIATEKRAFLIDELNKLKN
EGPQKKNKAGPIAPSEFVPSKGSVTLSEIRLPLKADFVCGTVQKPDAANYYFLIILKAGP
ENMVATPLACTSNSLNGDALTFTTTFTLQDVSNDFEINIEVYSLVQKKDLSGPDKKKKAY
KSKAITPKRLLTSITTKSSLHSSVMASPGGLNAVRTSNFALVGSYMLSLSSVGNTKFALD
KVPFLSPLEGHIYLKIKCQVNSSVEERGFLTIFEDVSGFGAWHRRWCVLSGNCISYWTYP
DDEKRKNPIGRINLANCTSHQIEPANREFCARRNTFELITVRPQREDDRETLVSQCRDTL
CVTKNWLSADTKEERDLWMQKLNQILVDIRLWQPDACYKPIGKP
Download sequence
Identical sequences M3Y8W0
XP_004742028.1.14098 ENSMPUP00000007767 ENSMPUP00000007767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]