SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007805 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007805
Domain Number 1 Region: 6-101
Classification Level Classification E-value
Superfamily PH domain-like 4.55e-17
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.095
Further Details:      
 
Domain Number 2 Region: 173-630
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000178
Family Armadillo repeat 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007805   Gene: ENSMPUG00000007863   Transcript: ENSMPUT00000007930
Sequence length 833
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896900.1:23672024:23711997:1 gene:ENSMPUG00000007863 transcript:ENSMPUT00000007930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDTRRRVKVYTLNEDRQWDDRGTGHVSSGYVERLKGMSLLVRAESDGSLLLESKINPNT
AYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDLVDESEEE
RFDDMSSPGLELPSCELSRLEEIAELVASSLPSPLRREKLALALENEGYIKKLLELFHVC
EDLENIEGLHHLYEIIKGIFLLNRTALFEVMFSEECIMDVIGCLEYDPALSQPRKHREFL
TKTAKFKEVIPISDPELKQKIHQTYRVQYIQDMVLPTPSVFEENMLSTLHSFIFFNKVEI
VGMLQEDEKFLTDLFAQLTDEATDEEKRQELVNFLKEFCAFSQTLQPQNRDAFFKTLSNM
GILPALEVILGMDDTQVRSAATDIFSYLVEYNPSMVREFVMQEAQQNDDVSKKLTEQKIT
NKDILLINLIIEHMICDTDPELGGAVQLMGLLRTLVDPENMLATANKTEKTEFLGFFYKH
CMHVLTAPLLANTTEDKPSKDDFQTAQLLALVLELLTFCVEHHTYHIKNYIINKDILRRV
LVLMASKHAFLALCALRFKRKIIGLKDEFYNRYIMKSFLFEPVVKAFLNNGSRYNLMNSA
IIEMFEFIRVEDIKSLTAHVIENYWKALEDVDYVQTFKGLKLRFEQQRERQDNPKLDSMR
SILRNHRYRRDARTLEDEEEMWFNTDEDDMEDGEAVVSPSDKTKNDDDIMDPISKFMERK
KLKESEEKEVLLKTNLSGRQSPSFKLSLSSGTKTSLTSQSPAANLPGSPGSPGSPGSPGS
PGSVPKSTSQTAAITTKGGLVGLVDYPDDDEDDDEDEDKEDTLPLSKKAKFES
Download sequence
Identical sequences M3Y8Z8
XP_004739108.1.14098 ENSMPUP00000007805 ENSMPUP00000007805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]