SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007807 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007807
Domain Number 1 Region: 99-287
Classification Level Classification E-value
Superfamily p53-like transcription factors 5.22e-75
Family T-box 0.000000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007807   Gene: ENSMPUG00000007865   Transcript: ENSMPUT00000007932
Sequence length 446
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896904.1:30053071:30108228:1 gene:ENSMPUG00000007865 transcript:ENSMPUT00000007932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEGTENTIKPLEQFVEKSSCAQPLGELTS
LDAHGEFGGGGSSPSSSSLCTEPLIPTTPIIPSEEMAKIACSLETKELWDKFHELGTEMI
ITKSGRRMFPTIRVSFSGVDPEAKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPPLPA
RLYVHPDSPFTGEQLLKQMVSFEKVKLTNNELDQHGHIILNSMHKYQPRVHIIKKKDHTA
SLLNLKSEEFRTFIFPETVFTAVTAYQNQLITKLKIDSNPFAKGFRDSSRLTDIERESVE
SLIQKHSYARSPIRTYGGEEDVLGDEVQTTQNRGSAFTTSENLSLSSWVSSSSSFPGFQH
PQPLTALGTSTASIATPIPHPIQGSLPPYGRLGMPLTPSAIASSMQGSGPTFPSFHMPRY
HHYFQQGPYAAIQGLRHSSAVMTPFV
Download sequence
Identical sequences M3Y900
ENSMPUP00000007807 ENSMPUP00000007807 XP_004742038.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]