SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007809 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007809
Domain Number 1 Region: 381-465
Classification Level Classification E-value
Superfamily SH3-domain 4.46e-19
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 2 Region: 124-190
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-18
Family SH3-domain 0.00081
Further Details:      
 
Domain Number 3 Region: 185-249
Classification Level Classification E-value
Superfamily SH3-domain 7.61e-16
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 4 Region: 8-70
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000872
Family RING finger domain, C3HC4 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007809   Gene: ENSMPUG00000007867   Transcript: ENSMPUT00000007934
Sequence length 733
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896911.1:9202640:9328606:-1 gene:ENSMPUG00000007867 transcript:ENSMPUT00000007934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDLTLLDLLECPVCFEKLDVTAKVLPCQHTFCKPCLQRIFKAHKELRCPECRTLVFCSI
EALPANLLLVRLLDGVRSGQSLGRGGSFRRPSMLTPQDSRKSRTNPRGLQSSPFRLVPNI
RIHMDGVPRAKALCNYRGQNPGDLKFNKGDVILLRRQLDEKWYQGEINGVSGIFPAGSVE
VIKQLPQPPPLCRALYNFDLRDKDRSENQDCLTFLKDDIITVISRVDENWAEGKLGDQVG
IFPILFVEPNLTARHLLEKNKGRQSARTKSLSLVPSSSRGKAANTPTLRRGPGSRRKGPG
QFSITTALNTLNRMVHSPSGRHMVEISTPVLISSSNPSVITQHMEKADLPPSSVGQVSAY
HPVPASLGHSTAIVSVPGSQQHLPANMFVALHSYSAHGPDELDLQKGEGIRVLGKYPDGW
LRGVSLVTGRVGIFPNNYVIPIFRKTSSFPDSRSPGLYTTWTLSNSSVSSQGSISEGDPR
QNRPFKSVFVPTAVVSPVRSTASPGTVRQGSLRKSGRSSMRKNGSLQRPVQSGIPALVVG
SLRRNPTMVVRPQQFQFCQPQGVPSSPSTVVAEVGPKPTPTGEPALTCVSRGSDTRIRSA
ASSLIMEGKEIPIKSEPLPKPPASAPPSILVKPENPRNGTEKQVKTVRFQNYSPPPAKQY
TSHPTAGKPEQPTTPKGSQPEAAPSGPEMNILFAHRSGCHSGQQTDLRRKSSLGKTVTPV
SATSATQTMFPSK
Download sequence
Identical sequences M3Y902
ENSMPUP00000007809 XP_012907796.1.14098 ENSMPUP00000007809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]