SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007823 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007823
Domain Number 1 Region: 535-781
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.87e-63
Family Nuclear receptor ligand-binding domain 0.000000000466
Further Details:      
 
Domain Number 2 Region: 423-504
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.69e-27
Family Nuclear receptor 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007823   Gene: ENSMPUG00000007881   Transcript: ENSMPUT00000007948
Sequence length 782
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896911.1:11594395:11718379:1 gene:ENSMPUG00000007881 transcript:ENSMPUT00000007948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSKESLSPPSKEEISSSVLGRERGNVMDFYKTLRGGATVKVSASSPSSLAAASQSDSKQ
QRLLVDFPKGPGSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETD
FRLLEESIANLNRSTSVPENPKSSASTAVSAAPMEREFSKTLSDVSSEQQNLKGQTGSNG
GNVKLCTTDQSTFDIWRKKLQDLEFSSGSPENEASESPWKSDLLIDENCLLSPLAGEDDP
FLLEGNSNEDCKPLVLPDTKPKIKDNGELILSSPNSVPLPQVKTEKEDFIELCTPGVIKQ
EKLGPVYCQGSFSGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASVSQQQDQKPIFNVI
PPIPVGSENWNRCQGSGDDSLASLGTLNFPGRSVFSNGYSSPGMRPDVSSPPSSSSAATG
PPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPA
CRYRKCLQAGMNLEARKTKKKIKGIQQATPGASQETSENPANKTIVPTTLPQLTPTLVSL
LEVIEPEVLYAGYDSSIPDTTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTL
LQYSWMFLMAFALGWRSYRQSSGNVLCFAPDLIINEQRMSLPCMYEQCKHMLFVSSELQR
LQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRF
YQLTKLLDSMHDVVENLLNFCFQTFLDKNMSIEFPEMLAEIITNQIPKYSSGNIKKLLFH
QK
Download sequence
Identical sequences M3Y916
XP_004744777.1.14098 ENSMPUP00000007823 ENSMPUP00000007823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]