SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007832 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007832
Domain Number 1 Region: 771-1104
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.71e-111
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000000000355
Further Details:      
 
Domain Number 2 Region: 7-137
Classification Level Classification E-value
Superfamily USP8 N-terminal domain-like 6.28e-48
Family USP8 N-terminal domain-like 0.00000041
Further Details:      
 
Domain Number 3 Region: 178-322
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 6.34e-34
Family Ubiquitin carboxyl-terminal hydrolase 8, USP8 0.000000445
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007832
Domain Number - Region: 646-681
Classification Level Classification E-value
Superfamily WW domain 0.0115
Family WW domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007832   Gene: ENSMPUG00000007890   Transcript: ENSMPUT00000007957
Sequence length 1116
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896946.1:11858829:11909692:-1 gene:ENSMPUG00000007890 transcript:ENSMPUT00000007957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAVASVPKELYLSSSLKDLNKKTEVKPEKISTRNYVQSALKIFKTAEECRLDRDEEKAY
VLYMKYVTVYNLIKKRPDFKQQQDYFHSILGLANIKKAIEEAERLSESLKLRYEEAEVRK
KLEEKDRQEEEQLQKQKRHEAGREDGGTSPKSSLENVMDSRDKTQKINGEKSEKSETTEK
GTITAKELYTMMMDENISLIIMDARRMQDYQDSHISNSLSVPEEAIRPGVTASWIEAKLP
DDSKDTWKKRGNVEYVVLLDWFSSTKDLQLGTILRSLKDALFKWESKTVLRNEPLVLEGG
YENWLLCYPQYTTNAKVTPPPRGKNEEVSISLDFTYPSLEESVPSKPTARMPPPSVEVDE
NRELINDQDERMATLNIPTPAESIAASKSDVLPIIQPVPIIKNVPQFDRTKKPAVRLPED
HRIKSENKDHEQQSPKDGKVVPDRSTKPVFPPPTAMLTDEEKARIHAETALLMEKNRQEK
ELRERQQEEQKEKLRREEQEQKARKKQEAEENEITEKQQKAKEEMEKRESEAKKEDKETS
AKRGREITGVKRQSKSEHETTDAKKSAEDRDKRCPTPELQQKAVGDVPHASVAGDSNSVK
PAKIKGQPESGILKTGTFRENTEDTERNKAREPLTRARSEEMGRIVPGLPSGWAKFLDPI
TGTFRYYHSPTNTVHMYPPEMAPSSAPPSTPPTHKAKPQIPAERDREPSKLKRSYSSPDI
TQAIQEEEKRKPTVTPAVNRENKPTCYPKAEITRLSASQIRNLNPVFGGSGPALTGLRNL
GNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQY
RYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRHKEENNDHLD
DFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKC
TLQDCLRLFSKEEKLTDNNRFYCSHCRTRRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQ
KLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRWFK
FDDHEVSDISVSSVKSSAAYILFYTSLGPRATDVAT
Download sequence
Identical sequences M3Y925
XP_004755503.1.14098 ENSMPUP00000007832 ENSMPUP00000007832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]