SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007833 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007833
Domain Number 1 Region: 473-765
Classification Level Classification E-value
Superfamily L domain-like 8.84e-44
Family Internalin LRR domain 0.035
Further Details:      
 
Domain Number 2 Region: 240-541
Classification Level Classification E-value
Superfamily L domain-like 1.43e-40
Family Leucine rich effector protein YopM 0.019
Further Details:      
 
Domain Number 3 Region: 773-1027
Classification Level Classification E-value
Superfamily PP2C-like 2.22e-40
Family PP2C-like 0.0023
Further Details:      
 
Domain Number 4 Region: 138-235
Classification Level Classification E-value
Superfamily PH domain-like 0.00000161
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007833   Gene: ENSMPUG00000007891   Transcript: ENSMPUT00000007958
Sequence length 1316
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896994.1:149463:213841:1 gene:ENSMPUG00000007891 transcript:ENSMPUT00000007958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRNGSRNCLNRRSRFGSRERDWLREDVRRGCVYLYGADSTTATASASASASSDLHLVLC
TVETPASEICAGEGRESLYLQLHGDLVRRLEPTERPLQIVYDYLSRLGFDDPVRIQEEAT
DPDLGCMLRFYGEKPCQMDHLDRILLSGIYNVRKGKTQLHKWAERLVVLCGTCLIVSSVK
DCQTGKMHILPLVGGKVEEVKRRQHSLAFSSAGAQAQTYHVSFETLAECQRWQRQASKVV
SQRISTVDLSCYSLEEVPEHLFYSQDITYLNLRHNFMQLERPGGLDTLYRFSQLKGLNLS
HNKLGLFPVLLCEISTLTELNLSCNGIHDLPSQIGSLLNLQTLCLDGNFLTTLPEELGNL
QQLSSLGISFNNFSQIPEVYEKLSMLDKVVMAGNRLEVLKLGVLSRMSHIRHVDFRMNHL
KTVVTENLEGNKYITHMDLRDNQLSDLDLSSLCSLEQLHCERNQLRELTLSGFSLRMLYA
SSNRLTAVNVYPVPSQLTSLELSRNLLECVPDWACEAKKMEILDVSYNLLTEVPLRILSS
LSLRKLMVGHNQVQSLPVLAEHIPLEALDIQHNLLTRLPDTLFSKALNLRYLNASANSLE
SLPSAGAGEESLSALQLLYLTNNLLTDQCVPVLVGHPHLRILHLANNQLQTFPASKLNKL
EQLEELNLSGNKLKTIPTTIANCKRLHTLVAHSNNISIFPEILQLPQIQFVDLSCNDLTE
ILIPEALPATLQDLDLTGNTNLVLEHKTLDTFSHITTLKIDQKPLPTTDATLTSTFWSHG
LAEMAGQRNKLCVSALAVDNFAEGVGAVYGMFDGDRNEELPRLLQCTMADVLLEEVQQST
NDTVFMANTFLVSHRKLGMAGQKLGSSALLCYIRPDTADPTSSFSLTVANVGTCQAVLCR
SGKPVPLSKVFSLEQDPEEAQRVKDQKAIITEDNKVNGVTCCTRMLGCTYLYPWILPKPH
ISATPLTIQDELLILGNKALWEYLSYTEAVDAVRHVQDPLAAAKKLCTLAQSYGCQDNVG
AMVVYLNIGEEGCTCEMNGLTLPGPVGFASTTVLKDPPKPTTPSSSSGIASEFGSEMSTS
EVSSEVGSTASDEHNTVGLDAGLLPRPERRCSLHPTPTSALFQRQPSCATFSSNQSDNGL
DSDDDQPVEGVITNGSKVEVEVDIHCCRGRDLENSPTLRENSPTPCPEEHARGSFFGIRR
QNSVNSGILVPGSKDRMELQKSPSTSCLYGKKLSNGSIVPLEDSLNLIEVATEAPKKKTG
YFAAPTQLEPEDQFVVPRDLEEEVKEQMKQHQESRPEPEPHEEDRTELPEEFDTAL
Download sequence
Identical sequences M3Y926
ENSMPUP00000007833 ENSMPUP00000007833 XP_004763497.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]