SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007890 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007890
Domain Number 1 Region: 5-219
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.41e-68
Family D-ribulose-5-phosphate 3-epimerase 0.00000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007890   Gene: ENSMPUG00000007948   Transcript: ENSMPUT00000008015
Sequence length 228
Comment pep:known scaffold:MusPutFur1.0:GL897025.1:5445699:5460727:-1 gene:ENSMPUG00000007948 transcript:ENSMPUT00000008015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQ
LGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK
PGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGP
DTIHKCAEAGANMIVSGSAIMRSDDPRSVINLLRNVCSEAAQKRSLDR
Download sequence
Identical sequences G9KLQ4 M3WAV5
XP_003991141.1.62641 XP_004767083.1.14098 XP_007086136.1.5354 XP_014929215.1.86478 XP_019301688.1.44245 XP_021558974.1.83697 ENSMPUP00000007890 ENSMPUP00000007890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]