SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007898 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007898
Domain Number 1 Region: 924-1054
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.28e-45
Family Regulator of G-protein signaling, RGS 0.00000628
Further Details:      
 
Domain Number 2 Region: 14-137
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.47e-23
Family Synaptotagmin-like (S variant) 0.0034
Further Details:      
 
Domain Number 3 Region: 170-250
Classification Level Classification E-value
Superfamily PDZ domain-like 3.46e-17
Family PDZ domain 0.0000158
Further Details:      
 
Domain Number 4 Region: 428-531
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000328
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007898   Gene: ENSMPUG00000007956   Transcript: ENSMPUT00000008023
Sequence length 1060
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896918.1:17252111:17354760:1 gene:ENSMPUG00000007956 transcript:ENSMPUT00000008023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTRRRSEVASVVSLGQLKLSIDAQDRVLLLHIIEGKGLMSRDPGICDPYVKISLIPENNR
LRRQKTRTVPDCREPVFREHFFFPVQEEDEQKRLLVTVWNRAGDSRQSGLIGCMSFGVKS
LLTPDKEVSGWYYLLGEDLGRTKHLKVARRRLRPLRDTLLRTPGGGDTEKGEKLKITIPR
GKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEHWKCVELAHEIRSC
PSEIILLVWRMVPQVKPGPDGGVLRRASCKSTHDLQSPPNKREKNCTHGAQARPEQRHSC
HLVCDSSDGLLLGGWERYTEVAKRGGQHTLPALSRATTSTDPNYIILAPLNPGSQLLRPV
YQEDAIPEESGSPSKGKSHTGLGKKSRLMKTVQTVKGRANYQNCPVMRPHTPHSSYGTYV
TLAPKVLVFPVFVQPLDLCNPARTLLLSEELLLYEGRNKAIEVTLFAYSDLLLFTKEDEP
GRCDVLRNPLYLQSVKLQEGSSEDLKFCVLYLAEKAECLFTLEAHSQEQKKRVCWCLSEN
IAKQQQLMASPPERKMSEPEADEKREMPLEEGKGLGAEDEPPSKDPSLGQEPPSGQDLPP
NKDPSAGQEPSPGQELPSSEDSPSCKERRPGQEPQPSKDSPPCQEPPAALALPLCQDLPA
GPEPPPSQDLPVIQDAPAQELAPCQDLPPGQVPQPAEETESSGEPPAATGDPPAASRPTF
VIPEVRLDSAYSQKAGAEGGSLADEEDGEEAEEGDEGEEEEEEDTSDDNYGEHREAKRSS
MIEAGQAEGGLSLRVQNSLRRRTHSEGSLLQDTRGPCFASDTTLHCSDGEGTASSWAMPS
PRTLKKELGRNGGSMHHLSLFFTGHRKMSGADAVGDDDEASRKRKSKNLAKDMKNKLGIF
RRRNESPGAQPAGKADKMVKSFKPTSEEALKWGESLEKLLLHKYGLAVFQAFLRTEFSEE
NLEFWLACEDFKKVKSQSKMTAKAKKIFAEYIAIQACKEVNLDSYTREHTKVNLQSVTRG
CFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
Download sequence
Identical sequences M3Y991
ENSMPUP00000007898 ENSMPUP00000007898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]