SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007905 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007905
Domain Number 1 Region: 30-235
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.72e-63
Family BAR domain 0.0000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007905   Gene: ENSMPUG00000007963   Transcript: ENSMPUT00000008030
Sequence length 555
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897098.1:3412374:3445408:1 gene:ENSMPUG00000007963 transcript:ENSMPUT00000008030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGKAGGAAGLFAKQVQKKFSRAQEKVLQKLGKTVETKDERFEQSANNFYHQQAEGQKL
YKDLKNFLNAVKVMHESSKRVSETLQEIYSSEWDGHEELKAIAGNNDLLWEDYEEKLADQ
ALRTMENYVAQFSEIKERIAKRGRKLVDYDSARHHLEAVQNAKKKDEAKTAKAEEEFNKA
QSVFEDLNQELLEELPVLYHSRIGCYVTIFQNISNLRDVFYREMSKLNHSLYEVMSKLEK
QHSNKVFVVKGVSSSSRRSLVISSPVPTSAVSSPLTSPTSPTALPLKNERDSVSASEEEL
ASDLAPGEKDSEIKDKETEEEESETSSSEEEESLPACNGPAQAQPSPPTEGGRSQEEVLP
CSPSPSPGSALTPSEQPSSLPEVVLRTRTSSEGAEQPKKRASIQRTSAPPNRPPPPRATP
SPRHSSGNIPSSPLASEQGSPASPRAFLGAGTPSPRTSLEVSPDPQPPEKPVRTSEAREK
ESINNLNPEELCISPTLMSEVFSESDVAKKMEGKEENSQLTSAESQDLQLHVSAVPEESN
VMPQEEVSTVQTDYL
Download sequence
Identical sequences M3Y998
ENSMPUP00000007905 XP_004774786.1.14098 ENSMPUP00000007905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]