SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007963 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007963
Domain Number 1 Region: 5-97
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-17
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007963   Gene: ENSMPUG00000008021   Transcript: ENSMPUT00000008088
Sequence length 639
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896994.1:648791:700087:-1 gene:ENSMPUG00000008021 transcript:ENSMPUT00000008088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGDPDVLEYYKNDHSKKPLRIINLNFCEQVDAGLTFNKKELQDSFVFDIKTSERTFYLV
AETEEDMNKWVQSICQICGFNQAEESTDSLRNLSSSSHGPRSSPAELSSSSQHLLRERKS
SAPSHSSQPTLFTFETPVSNHMQPALSTSAPQEYLYLHQCISRRAENARSASFSQGTRAS
FLMRSDTAVQKLAQGNGHCVNGVSGQVHGFYSLPKPSRHNTEFRDSTYDLPRSLASHGHT
KGSLTGSETDNEDVYTFKTPSNTLCREFGDLLVDNMDVPATPLSAYQIPRTFTLDKNHNA
MAVATPGDSAIAPPPRPPKPSQAETPRWGSPQQRPPISESSRSISAAATIPRRNTLPAMD
NSRLHRASSCESYEYPQRGGESAGRSAESMSDAVGSFLPGKTAVGRSESSNSEDNYVPMN
PGSSTLLATERAGDNSQSVYIPMSPGPHHFEALGYPSAALSMHRGPSRGSEIQPPPVNRN
LKPDRKVKPTPLDLRNNTVIDELPFKSPVTKSWSRAIHTFNSSSQYCRPISTQSITSTDS
GDSEENYVPMQNPVSASPIPSGTNSPAPKKSTGSVDYLALDFQPSSPSPHRKPSTSSVTS
DEKVDYVQVDKEKTQALQSTMQEWTDVRQSSEPSKGAKL
Download sequence
Identical sequences M3Y9F6
ENSMPUP00000007963 ENSMPUP00000007963 XP_004763523.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]