SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007966 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007966
Domain Number 1 Region: 538-606
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000694
Family HLH, helix-loop-helix DNA-binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007966   Gene: ENSMPUG00000008024   Transcript: ENSMPUT00000008091
Sequence length 652
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897163.1:1016672:1049268:1 gene:ENSMPUG00000008024 transcript:ENSMPUT00000008091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQPQRMAPVGTDKELSDLLDFSMMFPLPAAHGKGRPTSLAGAQFGGSGLEDRPSSGSWA
TGDQNNSSFDPSRTYGDGTHFSEPHGSLSSSTFLGPGLGGKGSERSAYTTFGRDAGVGGL
SQASFPPSELALGSPGPLSPSGPKAGVQYYSYPGHARRRAAEGGLDSQPKKVRKVLPGLP
SSVYPSSSGEDYGRDSTAYAPAKAPSSAYPPHFYMADGSLHPAAELWSPSGQAGFGPVLG
GASSPLPLPPGGGSSVGGTAGFGSLHQHERMGYQLHGTEVNGGLPAASGFSSAPAAAYGG
VSSHTPPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGL
AGTSQWPRPGAPGALSPSYDGGLHSLQNKMEDRLDEAIHVLRSHAVGASADVHGLLPSHG
ALASGFTGPVMPLGGRHTGLVGGGPSEDSLAGSSSLLHNHVALPSQPGALPELARPPDSY
SGLARVGAVSGAGEIKREEKEDEENTSAADNSEEDKKELKPPRPRTSPDEDEDDLLPPEQ
KAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNL
EQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAAHPGLGEAHNPAGHL
Download sequence
Identical sequences M3Y9F9
XP_004778092.1.14098 ENSMPUP00000007966 ENSMPUP00000007966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]