SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007971 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007971
Domain Number 1 Region: 221-366
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000000455
Family Retroviral integrase, catalytic domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000007971
Domain Number - Region: 71-184
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.068
Family FCH domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007971   Gene: ENSMPUG00000008029   Transcript: ENSMPUT00000008096
Sequence length 441
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896973.1:6005117:6007942:1 gene:ENSMPUG00000008029 transcript:ENSMPUT00000008096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRASGKACCMDTMLDGYENVVPQGSFLQLSTMPQKPGNDPPHVSTTSDTETEIHHMREKF
LASVTKLVESKSYNSKVFSKEKYFQTIKEVKEAKEKGKKSSRDYRRAAKYDVISVQGTEK
LIKATHGERDRIRYYVHKEELFDILHDTHLNIGHGGRTRMLKELQGKYGNVTKEVIVLYL
TLCKQCYQKNPVPKRGLAPKPMPSKDTDSRCQVEVLDMQSNADGEFKFILYYQDHLTKFI
ILRPLKAKRAHEVVIVLLDIFTILGTPRVLDSGSGVEFTNQVVHELSKVWPDLKVACGKQ
RPGQGPGSLEQVSHDVKNMVRAWMQSNRSCCWAEGLRFIQMARNQMFDVSLQRSPYEAMF
GFKAKLGLYSSHLPRETVAILQTEEELEIAEEQLESSLWRGQEERTEVAADRSDVDEDLD
PTAPEAAEPSTSQGAPRLFCW
Download sequence
Identical sequences M3Y9G4
ENSMPUP00000007971 ENSMPUP00000007971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]