SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007976 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007976
Domain Number 1 Region: 41-115
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000373
Family Rhamnogalacturonase B, RhgB, middle domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007976   Gene: ENSMPUG00000008034   Transcript: ENSMPUT00000008101
Sequence length 241
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896926.1:545075:751284:1 gene:ENSMPUG00000008034 transcript:ENSMPUT00000008101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVWGFFSVLLLLLSGDAQSSELPGATADGSGGTGVGTGDRFKIEGRAVVPGVKPQDW
ISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVISPAYRFDPVRVDITSKGKMRAR
YVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTDFLMNPMVMMMVLPLLIFVLLPK
VVNTSDPDMRREMEQSMNMLNSNHELPDVSEFMTRLFSSKSSGKSSSGSSKTGKSGAGKR
R
Download sequence
Identical sequences M3Y9G9 U6CWF0
ENSMPUP00000007976 XP_004751079.1.14098 ENSMPUP00000007976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]