SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007989 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007989
Domain Number 1 Region: 400-619
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.4e-51
Family DBL homology domain (DH-domain) 0.00037
Further Details:      
 
Domain Number 2 Region: 610-740
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000486
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007989   Gene: ENSMPUG00000008047   Transcript: ENSMPUT00000008114
Sequence length 842
Comment pep:known scaffold:MusPutFur1.0:GL896973.1:6036970:6048234:-1 gene:ENSMPUG00000008047 transcript:ENSMPUT00000008114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAQSLPAATPPTQKPPRIIRPRPPSRPRAAQSPGDHHNGSSPQEPALTSNDAPTPVGTP
IHWDPPASSLKPPALLPPSASKASLDSQTSPDSPSSTPSPVSRRSVTPEPAPRSPIPPPK
PSGSHTLPLLPTPGVPTQGGSASAPGTVRRLAGKFEWGTESRVQAAEALESGPQGAANVN
GEREAPQGNLAGSGSQENGTPDAGLACPPCCPCVCHIGRPGLELRWVPVGSYEDGPRAFC
RASPLRASRSRPSPPSIGLPPVVLTSYRSTAEHKLLPPLKAPKPTWVRQDTTVSGDPPQP
DLDPPSEDGIHTEDNPDETPQNTPPAKTEGRDKEGLEELKEQNWELPLQDEPLYQNYRAA
VLSEELWGVSEDGCPSPTTPGEGPTFARPPGPRNTLWQELPAVRASGLLDTLSAQERRMQ
ESLFEVVTSEASYLRSLRLLTDTFVLSQALRDTLTPRDHHTLFSNVQRVQGVSERFLGTL
LSRVRSSPHISDLCDVVHDHAVGPFSVYVDYVRNQQYQEETYSRLMDTNVRFSAELRRLQ
SLPKCERLPLPSFLLLPFQRITRLRMLLQNILRQTEEGSSRQENAQKALSAVSKIIERCS
AEVGRMKQTEELIRLTQRLRFHKVKALPLVSWSRRLELQGELTELGCRRGGVLFTSRPRF
TPLCLLLFSDLLLITQPKSGQRLQVLDYAHRSLVQAQQVPDPSGPPTFRLSLLSNHQGRP
THRLLQASSLSDMQRWLGAFPTPGPLPCSPDTVYEDCDCSQELCSEPSAAARTEGRRLES
RAPPKHPHKSPEGWLKGFPGAFPAQLVCEVTGEHERRKHLRQHQRLLEAVGPSSGSTSAS
PP
Download sequence
Identical sequences M3Y9I2
ENSMPUP00000007989 XP_004760262.1.14098 ENSMPUP00000007989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]