SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008012 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008012
Domain Number 1 Region: 120-246
Classification Level Classification E-value
Superfamily PH domain-like 7.13e-44
Family Phosphotyrosine-binding domain (PTB) 0.000000874
Further Details:      
 
Domain Number 2 Region: 556-621
Classification Level Classification E-value
Superfamily SH3-domain 2.8e-16
Family SH3-domain 0.00029
Further Details:      
 
Domain Number 3 Region: 715-772
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000513
Family Pointed domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008012   Gene: ENSMPUG00000008071   Transcript: ENSMPUT00000008138
Sequence length 802
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897135.1:2261882:2273070:-1 gene:ENSMPUG00000008071 transcript:ENSMPUT00000008138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTETVTAPGSPQAAPVPPTPPQPGCLCQPRPGARAVGLCPVSALVCGGGRARRGAGRTGQ
AFGTLEQQRAGPLRWQGTSRWQELPILTMSTSKGPEAAPKPSAKSIYEQRKRYSTVVMAD
VSQYLVNHLVTFCLGEEDGVHTVEDASRKLAVMDSQGRIWAQEMLLRVSPDHVTLLDPIS
KEELELYPLGAIVRCDAVLPPGRSRSLLLLVCQEPERTHPDVHFFQGLRLGAELIREDIQ
GALHDYRSGRGERRPAALRATQEELQRRPSPVAETPPLQRRPSVRAVISTVSAGRGHSQA
EPIPEAEESQRPGLAGTAGSPDPASPDLGPRGPELASLQAERDVDILNHVFDDVESFVSR
LQKSAEAARVLEHRERGRRTRRREAGEGLLTLRAKPPSEAEYTDVLQKIKYAFSLLARLR
GNIANPSSPELLHFLFGPLQLVVDTSGGPRFASEVRRPHLTSEAVALLRDHLTPRENALW
TSLGDSWTRPGLELPPEEGSPYSPEFSSGWEPPATDPQGRAWEDPVEKQLQHERQRQQQS
VPQVAVNGWVRCHQDPEPEAEPQPDGKWVLCNYDFQARNSSELSVKQQDVLEVLDDRRKW
WKVRDQQGQEGYVPYNILTPHLRPRGSCSHSPSGSLAASTPHHAPAPASAPTSSRPHWDS
CDNLNLDPREKERFSQMLCVNEELQARLAQGRSGPSRAAPGPRALEPQLSPHSDTAEVRA
WLQTKGFSAQTVEALGVLTGAQLFTLQKEELRAVSPEEGARVYSQVTVQRALLEDKEEVS
ELEAVMEKQKKKVEGDLETEVI
Download sequence
Identical sequences M3Y9K5
ENSMPUP00000008012 ENSMPUP00000008012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]