SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008036 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008036
Domain Number 1 Region: 14-152
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.83e-41
Family RPR domain (SMART 00582 ) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008036   Gene: ENSMPUG00000008094   Transcript: ENSMPUT00000008162
Sequence length 1555
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896994.1:5409589:5431643:1 gene:ENSMPUG00000008094 transcript:ENSMPUT00000008162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEQTPAEAGTAGAREDACRDYQSSLEDLTFNSKPHINMLTILAEENLPFAKEIVSLIEA
QTAKAPSSEKLPVMYLMDSIVKNVGREYLTAFTKNLVATFICVFEKVDENTRKSLFKLRS
TWDEIFPLKKLYALDVRVNSLDPAWPIKPLPPNVNTSSIHVNPKFLNKSPEESSTPGTVV
SSPSISTPPIVPDIQKNLTQEQLIRQQLLAKQKQLLELQQKKLELELEQAKAQLAVSLSV
QQETSNLGPGSAPSKLHVPQITPMAVKPPHQVPVQPEKSRPGPSLQIQDLKGTNRDPRLN
RMSQHSSHGKDQSHRKEFLMNTLSQSDIKTSKTVPSEKLNSSKQEKSKSGEKITKKELDQ
LDSKSKSKSKSPSPLKNKLSHTKDLKNQESESARVSDMSKRDPRLKKHLQDKTDSKDDDV
KEKRKTTEKKDKDEHMKSSEHRLVGSRNKIINGIVQKQDTTTEESEKQGIKPGRSSTRKR
SRSRSPKSRSPIIHSPKRRDRRSPKRRQRSMSPTSTPKAGKIRQSGIKQSHMEEFTLPSR
EERNAKRSNKQDIRDPRRIKKTEEERPQEGANQHSTKSGTEPKENVENWQSSKSTKRWKS
GWEENKSLQQGDEHSKSPHLRHRESWSSTKGILSPRAPKQQHRLSVDANLQIPKELTLAS
KRELLQKTSERLASGEITQDEFLVVVHQIRQLFQYQEGVREEQRSPFNDRFPLKRPRYED
SDKPFVDSPASRFAGLDTNQRLTALAEDRPLFDGPGRPSVTRDGPTKMIFDGPNKLSPRI
DGPPTPGSLRFDGSPGQMGGGGPLRFEGPQGQLGGGCPLRFEGPPGPVGTPLRFEGPIGQ
AGGGGFRFEGSPGLRFEGSAGGLRFEGPGGQPVGGLRFEGHRGQPVGGLRFEGPHGQPVG
GLRFDNPRGQPVGGLRFEGGHGPSGGAMRFDGPHGQPAGGIRFEGPLLQQGVGMRFEGPH
GQSVAGLRFEGQHNQLGGNLRFEGPHGQPGVGIRFEGPLVQQGGGMRFEGPSVPGGGLRI
EGPLGQGGPRFEGCHALRFDGQPGQPSLLPRYDGLHGQPGPRFERTGQPGPQRFDGPPGQ
QVQPRFDGVPQRFDGPQHQQASRFDIPLGLQSSRFDNHPSQRLESVSFSQTGPYNDPPGN
AFNAPSQGLQFQRHEQMFDSPQGPNFNGPHGPGNQSFSNPLNRASGHYFDEKNIQSSQFG
NFGNLPAPITVGNIQASQQVLTGVAQPVAFGQGQQFLPVHPQNPGAFVQNPSGGLPKAYP
DNHLSQVDVNELFSKLLKTGILKLSQPDSATTQVNEVAAQPPPEEEEDQNEDQNVPDLTN
FTIEELKQRYDSVINRLYTGIQCYSCGMRFTTSQTDVYADHLDWHYRQNRTEKDVSRKVT
HRRWYYSLTDWIEFEEIADLEERAKSQFFEKVHEEVVLKTQEAAKEKEFQSVPAGPAGAV
ESCEICQEQFEQYWDEEEEEWHLKNAIRVDGKIYHPSCYEDYQNTSSFDCTPSPSKTPVE
NPLNIMLNIVKNELQEPCESPKVKEERIDTPPACTEESIAAPTEIKTENDTVESV
Download sequence
Identical sequences M3Y9M9
ENSMPUP00000008036 XP_004763538.1.14098 ENSMPUP00000008036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]