SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008068 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008068
Domain Number 1 Region: 641-830
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.94e-56
Family Nucleotide and nucleoside kinases 0.0000000952
Further Details:      
 
Domain Number 2 Region: 377-474
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-32
Family PDZ domain 0.000077
Further Details:      
 
Domain Number 3 Region: 478-592,635-669
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-31
Family SH3-domain 0.0000716
Further Details:      
 
Domain Number 4 Region: 49-152
Classification Level Classification E-value
Superfamily PDZ domain-like 7.23e-30
Family PDZ domain 0.000041
Further Details:      
 
Domain Number 5 Region: 156-250
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-27
Family PDZ domain 0.0000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008068   Gene: ENSMPUG00000008125   Transcript: ENSMPUT00000008194
Sequence length 833
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896994.1:5639655:6360734:-1 gene:ENSMPUG00000008125 transcript:ENSMPUT00000008194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRPSASRAENYQLLWDTIASLKQCEQAMQHAFIPASPAPIIVNTDTLDTIPYVNGTEIE
YEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRV
NEVDVSEVSHSKAVEALKEAGSIVRLYVRRRRPILETVVEIKLFKGPKGLGFSIAGGVGN
QHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILKNTSDVVY
LKVGKPTTIYMTDPYGPPDITHSYSPPMENHLLSGNNGTLEYKTSLPPISPGRYSPIPKH
MLVEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSAPYPHYHLGLLPDSEMT
SHSQHSTATRQPSVTLQRAISLEGEPRKVVLHKGSTGLGFNIVGGEDGEGIFVSFILAGG
PADLSGELQRGDQILSVNGIDLRGASHEQAAAALKGAGQTVTIIAQYQPEDYARFEAKIH
DLREQMMNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGLSFKYGDILHVINA
SDDEWWQARRVTLEGDSEEMGVIPSKRRVERKERARLKTVKFNAKPGVIDSKGDIPGLGD
DGYGTKTLKHVSSNASDSESSYRGQEDFILSYEPVTRQEINYTRPVIILGPMKDRINDDL
ISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGT
SVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPKSLEPLMEMNKRLTEEQAK
KTYDRAIKLEQEFGEYFTAIVQGDTLEDIYNQCKLVIEEQSGPFIWIPSKEKL
Download sequence
Identical sequences A0A2I2U7E4 M3Y9R1
ENSMPUP00000008068 ENSMPUP00000008068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]