SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008079 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008079
Domain Number 1 Region: 6-106
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.05e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008079   Gene: ENSMPUG00000008138   Transcript: ENSMPUT00000008207
Sequence length 417
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896972.1:8185633:8196124:1 gene:ENSMPUG00000008138 transcript:ENSMPUT00000008207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGKHRGLGVHLSFVR
SVTMDKWKDAELEKMKAGGNAKFREFLESQEDYDPCWSLQDKYNSKAAALFRDKVATLAE
GKEWSLESSPAQNWTPPQPKTLSSTAHRAPGHPQTSTSSSDKAFEDWLNDDLGSYQGAQE
NRYVGFGNTVPPPKREEDFLSSAVSSLCSGWSSFTTGASKFASAAKEGATKFGSQASQKA
SELGQSLNENVLKPAQEKVKEGRLFDDVSSGVSQLASKVQGVGSRGWRDVTTFFSGRAED
PSDRPLEGQSYQNSGGDHALNRTVDQSFWETFGSAESTKGHRSPSSDSWTCADASAEKRS
SDSWDVWGSGSASTNKNSDHSDLGEAWAGSGEGRAKTAKKATPPVLPVDEGWDTQDW
Download sequence
Identical sequences M3Y9S2
ENSMPUP00000008079 ENSMPUP00000008079 XP_004760075.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]