SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008098 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008098
Domain Number 1 Region: 200-252
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000259
Family Myb/SANT domain 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000008098
Domain Number - Region: 303-346
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0342
Family Erythroid transcription factor GATA-1 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008098   Gene: ENSMPUG00000008158   Transcript: ENSMPUT00000008227
Sequence length 633
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897365.1:88536:106362:-1 gene:ENSMPUG00000008158 transcript:ENSMPUT00000008227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENPEMVDLPEKLKHQLRHRELFLSRQLESLPATHIRGKCSVTLLNETESLKSYLEREDF
FFYSLVYDPQQKTLLADKGEIRVGNRYQADITDLLKEGEEDGRDQSRLETKVWEAHNPLI
DKQIDQFLVVARSVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLHKSVYDVA
KAISALVPQGGPVLCRDEMEEWSASEASLFEEALEKYGKDFTDIQQDFLPWKSLTSIIEY
YYMWKTTDRYVQQKRLKAAEAESKLKQVYIPNYNKPNPNQISANNVKAGVVNGAGAPGQS
PGAGRACESCYTAQSYQWYSWGPPNMQCRLCASCWTYWKKYGGLKMPTRLDGERPGPNRS
NMSPHGIPARSSGSPKFAMKTRQAFYLHTTKLTRIARRLCREILRPWHAARHPYVPINSA
AIKAECTARLPEASQSPLVLKQAVRKPLEAVLRYLETHPRPPKPDPVKSVSGVLGGLTPA
KSAPVINNGSPTILGKRSYEQHNGVDGSMKKRLLMPSRGTYLGLANHGQTRHMGPSRNLL
LNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKVRKLLSSSETKRAAR
RPYKPVALRQSQALPLRPPPPAPVNDEPIVIED
Download sequence
Identical sequences M3Y9U1
ENSMPUP00000008098 ENSMPUP00000008098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]