SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008157 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008157
Domain Number 1 Region: 39-97
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000209
Family HLH, helix-loop-helix DNA-binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008157   Gene: ENSMPUG00000008217   Transcript: ENSMPUT00000008286
Sequence length 253
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896973.1:6204563:6210560:1 gene:ENSMPUG00000008217 transcript:ENSMPUT00000008286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGGPTPGCEQPGAPSLACRHFIWKPPSAHAPFCRGSSSWFEMLKPLVEKRRRDRINRS
LEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLRERSRVEPPGVPRSPAQDAEALASC
YLSGFRECLLRLAAFAHDASPAARAQLFSALHGYLRPKPPRPEPVDPRPQAPRPPLDPAA
PAPGPALHQRPAVHQGPRSPRCAWSPSPCSPRAGDCGAPAPLTGLLPPPPPHRQDGAPKA
PPPPPPAFWRPWP
Download sequence
Identical sequences M3YA00
XP_004760288.1.14098 ENSMPUP00000008157 ENSMPUP00000008157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]