SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008170 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008170
Domain Number 1 Region: 222-486
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.44e-51
Family Extended AAA-ATPase domain 0.000013
Further Details:      
 
Domain Number 2 Region: 87-200
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 1.41e-36
Family Cdc48 domain 2-like 0.000000729
Further Details:      
 
Domain Number 3 Region: 498-733
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.02e-35
Family Extended AAA-ATPase domain 0.00000000124
Further Details:      
 
Domain Number 4 Region: 1-85
Classification Level Classification E-value
Superfamily ADC-like 2.36e-30
Family Cdc48 N-terminal domain-like 0.00000857
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008170   Gene: ENSMPUG00000008230   Transcript: ENSMPUT00000008299
Sequence length 752
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897072.1:814539:966194:1 gene:ENSMPUG00000008230 transcript:ENSMPUT00000008299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRSMQAARCPTDELSLTNCAVVNEKDFQPGQHVIVRTSPNHRYTFTLRTHPSVVPGTI
AFSLPQRKWAGLSIGQEIEVSLYTFDKAKQCIGTMTIEIDFLQKKSIDSNPYDTDKMAAE
FIQQFNNQAFSVGQQLVFSFNEKLFGLLVKDIEAMDPSILKGEPATGKRQKIEVGLVVGN
SQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVF
PPEIVEQMGCKHVKGILLYGPPGCGKTLLARQIGKMLNAREPKVVNGPEILNKYVGESEA
NIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKIDG
VEQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDEKGRLQILHIHTARMRGHQLL
SADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTRGDF
LASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLEDGELLVQQTKNSDRTPLVSVL
LEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCV
VVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNA
FSTTIHVPNIATGEQLLEALELLGNFKDKERTTISQQVKGKKVWIGIKKLLMLIEMSLQM
DPEYRVRKFLALLREEGASPLDFENGLFEHAQ
Download sequence
Identical sequences M3YA13
ENSMPUP00000008170 ENSMPUP00000008170 XP_004772505.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]