SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008171 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008171
Domain Number 1 Region: 1478-1610
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.84e-25
Family Synaptotagmin-like (S variant) 0.064
Further Details:      
 
Domain Number 2 Region: 959-1095
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.12e-21
Family Synaptotagmin-like (S variant) 0.044
Further Details:      
 
Domain Number 3 Region: 398-541
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.4e-21
Family Synaptotagmin-like (S variant) 0.033
Further Details:      
 
Domain Number 4 Region: 253-379
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.04e-17
Family Synaptotagmin-like (S variant) 0.023
Further Details:      
 
Domain Number 5 Region: 1698-1855,1882-1896
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000421
Family Synaptotagmin-like (S variant) 0.018
Further Details:      
 
Domain Number 6 Region: 6-121
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000115
Family Synaptotagmin-like (S variant) 0.06
Further Details:      
 
Domain Number 7 Region: 1126-1226
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000655
Family Synaptotagmin-like (S variant) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008171   Gene: ENSMPUG00000008231   Transcript: ENSMPUT00000008300
Sequence length 2000
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897286.1:209904:301166:1 gene:ENSMPUG00000008231 transcript:ENSMPUT00000008300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALFVHLKTVSELRGRGDRIAKVTFRGQAFYSRVLENCEDVADFDETFRWPVGSNIDSNE
ILEIQIFNYSKVFSNKLIGTFRMVLQKVVEENHVEVTDTLMDDKNAVIKTSLCVEVRYQA
TDGTVGSWDDGDFLGDESLQEEGKDSQETDGLLPSSCPSSRTPGEKSFRRKKGNTMILLL
ELRETDSNQSLPKRADEPAVLEMEDLDRLAIRLGDGLDPDSVSLASVTALTTNVSNKRSK
PDIKMEPCAGRPMDFQISITVIEARQLVGLNMDPVVCVEVGDDKKCTSMKESTNCPYYNE
YFVFDFHVSPDVMFDKIIKISVIHSKNLLRSGTLVGSFKMDVGTVYSQPEHQFHHKWAIL
SDPDDISAGLKGYVKCDVAVVGKGDNIKTPHKANETDDDDIEGNLLLPEGVPPERQWARF
YVKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVSFAGQKGKTSVQKSSYEPLWN
EQVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDKGFLPTLGPAWVNM
YGSTRNYTLLDEHQDLNEGLGEGVSFRARLMLGLAVEILDTSNPELTSSTEVQVEQATPV
SESCTGKTEEFFLFGAFLEASMIDRKNGDKPITFEVTIGNYGNEVDGLSRPQRPQPRKEP
GDEEEVDLIQNSSDDEADEGGDLASVSSTPPMRPQVTDRNYFHLPYLDRKPCIYIRSWWP
DQRRRLYNANIMDHIADKLEEGLNDVQEMIKTEKSYPERRLRGVLEELSCGCYRFLSLAD
KDQGHASRTKLDRERLKSCMRELESMGQQAKTLRAQVKKHTVRDKLRLCQNFLQKLRFLA
DEPQHSIPDVFIWMLSNNKRVAYARVPSKDLLFSMVEEELGKDCAKVKTLFLKLPGKRGF
GSAGWTVQAKLELYLWLGLSKQRRDFLSGLPCGFEEVKATQGLGLLSFPPISLVYTKKQA
FQLRVHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELY
GEAQELRDDPPIIVIEIYDQDTMGKADFMGRTFAKPLVKMADEGYCPPRFPPQLEYYQIY
RGNATAGDLLAAFELLQIGPAGKADLPPINGPMDMDRGPIMPVPVGIRPVLSKYRIEVLF
WGLRDLKRVNLAQVDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLH
PPLNIRVVDCRAFGRYTLVGSHAVSSLRRFIYRPPDRSAPSWNTTARLLRDGRVLCNGGP
SSHPTGEVVVNMEPEVPVKKLETMVKLDATSDAVIKVDVADEEKEKKKKKKKGSSEEPEE
EEPDESMLDWWSKYFASIDTMKEQLRQQEASGIDLEEKEEVDNTEGLKGPMKGKEKAKAV
KEEKKKRTQNPGAGQGSEAPEKKKPKIDELKVYPKELESEFDNFEDWLHTFNLLRGKTGD
DEDGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYDPTYGMFQGIPSNDPINVLVRVYV
VRATDLHPADINGKADPYIAIRLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLT
VAVYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSIHGYNIWRDPMKPSQILTR
LCKESKVDGPHFGPPGRVKVSNRVFTGPSEIEDENGQRKPTEEHVALCALRHWEDIPRVG
CRLVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIV
WNTDEVVLEDDDFFTGEKSSDIFVRGWWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPF
DYLAAEEKIVISKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRG
AKTAKQCTMEMATGEVDVPLVSIFKQKRVKGWWPLLARNENDEFELTGKVEAELHLLTAE
EAEKNPVGLARNEPDPLEKPNRPDTAFVWFLNPLKSIKYLICTRYKWLIIKIVLALLGLL
MLALFLYSLPGYMVKKLLGA
Download sequence
Identical sequences M3YA14
ENSMPUP00000008171 ENSMPUP00000008171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]