SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008193 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008193
Domain Number 1 Region: 14-125
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008193   Gene: ENSMPUG00000008255   Transcript: ENSMPUT00000008324
Sequence length 443
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896926.1:5212263:5319166:1 gene:ENSMPUG00000008255 transcript:ENSMPUT00000008324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEETATSDNDNSYARVRAVVMTRDDSSGGWLPLGGSGLSCVTVFKVPHQEENGCADFFI
RGERLRDKMVVLECMLKKDLIYNKVTPTFHHWKIDDKKFGLTFQSPADARAFDRGIRRAI
EDISQGCPTFKNEAEGTEDDLQAAEEDTSSSLVKDHLFQQETVVTSEPYRSSRPSAFEDL
NARRVYLQSQANQITFSHPGLDIQSRSIEYVQRQISKDCGSLKSQNRVPLKSIRHVSFQD
EDEIVRINPRDILIRRYADYRHPDMWKNDLERDDTDSNIQFSKPDSKKSDYLYSCGDETK
LSSLKDSVVFKTQPSSLKFKKSKRRKEDGERSRCVYCQERFNHEENGRGKCQDAPDPIKR
CIYQVSCMLCAESMLYHCMSDSEGDFSDPCSCDTSDDKFCLRWLALVALSFIVPCMCCYV
PLRMCHRCGEACGCCGGKHKAAG
Download sequence
Identical sequences M3YA36
XP_004751130.1.14098 ENSMPUP00000008193 ENSMPUP00000008193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]