SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008194 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008194
Domain Number 1 Region: 380-610
Classification Level Classification E-value
Superfamily TPR-like 2.28e-22
Family Tetratricopeptide repeat (TPR) 0.037
Further Details:      
 
Domain Number 2 Region: 707-787
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000247
Family Tetratricopeptide repeat (TPR) 0.092
Further Details:      
 
Domain Number 3 Region: 170-244
Classification Level Classification E-value
Superfamily TPR-like 0.000000000632
Family HAT/Suf repeat 0.055
Further Details:      
 
Domain Number 4 Region: 25-80
Classification Level Classification E-value
Superfamily TPR-like 0.00000000139
Family HAT/Suf repeat 0.023
Further Details:      
 
Domain Number 5 Region: 210-262,315-366
Classification Level Classification E-value
Superfamily TPR-like 0.000059
Family Tetratricopeptide repeat (TPR) 0.063
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000008194
Domain Number - Region: 572-689
Classification Level Classification E-value
Superfamily TPR-like 0.000632
Family Tetratricopeptide repeat (TPR) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008194   Gene: ENSMPUG00000008256   Transcript: ENSMPUT00000008325
Sequence length 916
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897062.1:3737085:3749713:1 gene:ENSMPUG00000008256 transcript:ENSMPUT00000008325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVMARLSRSERPDLVFEEEDLPYEEEIMRNQFSVKCWLRYIEFKQGAPKPRLNQLYERA
LKLLPCSYKLWYRYLKARRAQVKHRCVTDPAYEDVNNCHERAFVFMHKVGRAEAGRGGAG
ELVGGLRPRQWAEWGESESCPLGRLAVELDLAVEEGVLGSPCASVPLRQMPRLWLDYCQF
LMDQGRVTHTRRTFDRALRALPITQHSRIWPLYLRFLRSHPLPETAVRGYRRFLKLSPES
AEEYIEYLKSSDRLDEAAQRLATVVNDERFVSKAGKSNYQLWHELCDLISQNPDKVQSLN
VDAIIRGGLTRFTDQLGKLWCSLADYYIRSGHFEKARDVYEEAIRTVMTVRDFTQVFDSY
AQFEESMIAAKMETASELGREEDDDVDLELRLARFEQLISRRPLLLNSVLLRQNPHHVHE
WHKRVALHQGRPREIINTYTEAVQTVDPFKATGKPHTLWVAFAKFYEDNGQLDDARIILE
KATKVSFKQVDDLASVWCECGELELRHENYDQALRLLRKATALPARRAEYFDGSEPVQNR
VYKSLKVWSMLADLEESLGTFQSTKAVYDRILDLRIATPQIVINYAMFLEEHKYFEESFK
AYERGISLFKWPNVSDIWSTYLTKFIARYGGRKLERARDLFEQALDGCPPKYAKTLYLLY
AQLEEEWGLARHAMAVYERATRAVEPAQQYDMFNIYIKRAAEIYGVTHTRGIYQKAIEVL
SDEHAREMCLRFADMECRLGEIDRARAIYSFCSQICDPRTTGAFWQTWKDFEVRHGNEDT
IREMLRIRRSVQATYNTQVNFMASQMLKVSGSATGTVSDLAPGQSGMDDMKLLEQRAEQL
AAEAERDQPPRAQSKILFVRSDASREELAELAQQANPEEIELGEDEDEDEMDLEPNEVRL
EQQSVPAAVFGSLKED
Download sequence
Identical sequences M3YA37
ENSMPUP00000008194 ENSMPUP00000008194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]