SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008206 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008206
Domain Number 1 Region: 2-325
Classification Level Classification E-value
Superfamily Ras GEF 7.59e-87
Family Ras GEF 0.00055
Further Details:      
 
Domain Number 2 Region: 386-454
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.54e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0011
Further Details:      
 
Domain Number 3 Region: 233-252,321-391
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000197
Family Calmodulin-like 0.036
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000008206
Domain Number - Region: 605-644
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0157
Family Mitotic arrest deficient-like 1, Mad1 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008206   Gene: ENSMPUG00000008268   Transcript: ENSMPUT00000008337
Sequence length 659
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896926.1:5467145:5494186:-1 gene:ENSMPUG00000008268 transcript:ENSMPUT00000008337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKMDASLTNTMEEFQELVKASGEESHCRLIDTTQINARDWSRKLTQRIKSNTSKKRKVS
LLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKENPTMERSIALCNGISQWV
QLMVLSRPTPQLRAEVFIKFIQVAQKLHQLQNFNTLMAVIGGLCHSSISRLKETSSHVPH
EINKVLGEMTELLSSCRNYDNYRRAYGECTQFKIPILGVHLKDLISLYEAMPDYLEDGKV
NVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLTLSLDLYYTEDEIYELSYAREPRNH
KAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFKNYDHDQDGYISQEEFEKI
AASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGFPHNFQETTYLKPTFCDNC
AGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNPAAPTENSPGGGPTSNLYPLG
AKDLLHAPEEGPFTFPNGETVEHSEESKDRTIMLMGVSSQKISVRLKRTVAHKATQTESL
PWLGTEAPSSSFRLSSPRKTAQDTLYVLPSPTSPCPSPVLIRKRAFVKWENKESLIKSKE
DLRHLRPPTYQELEQEINTLKADNDALKIQLKYAQKKIETLQLASKNHVLAQMDHSDCS
Download sequence
Identical sequences M3YA49
ENSMPUP00000008206 ENSMPUP00000008206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]