SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008217 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008217
Domain Number 1 Region: 112-177
Classification Level Classification E-value
Superfamily Ras GEF 0.0000209
Family Ras GEF 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008217   Gene: ENSMPUG00000008279   Transcript: ENSMPUT00000008348
Sequence length 178
Comment pep:novel scaffold:MusPutFur1.0:GL896926.1:5496711:5571499:-1 gene:ENSMPUG00000008279 transcript:ENSMPUT00000008348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLPCGLQTVCLRYLKFRWGGRNRWAQLHSATVPVRSPLIDSLPSCCRSFCWQSLSAGKKR
KELESHQFHLILSLCRKPSHGCRAATKARLEAKPAGSPVPSHRIPAQITQFRMMVSLGHL
AKGASLDELIDSCIQSFDADGNLCRSNQLLQVMLTMHRIIISSAELLQKVITLYPSAQ
Download sequence
Identical sequences M3YA60
ENSMPUP00000008217 ENSMPUP00000008217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]