SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008231 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008231
Domain Number 1 Region: 92-452
Classification Level Classification E-value
Superfamily ARM repeat 9.05e-110
Family Diap1 N-terninal region-like 0.00000000000622
Further Details:      
 
Domain Number 2 Region: 751-764,794-1173
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 1.06e-108
Family Formin homology 2 domain (FH2 domain) 0.0000000000254
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000008231
Domain Number - Region: 471-549
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0146
Family FCH domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008231   Gene: ENSMPUG00000008293   Transcript: ENSMPUT00000008362
Sequence length 1281
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896911.1:13242250:13334303:1 gene:ENSMPUG00000008293 transcript:ENSMPUT00000008362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLGGGQGPGRGPRDKKKGRSPDELPAAGGDGGKSKKFTLKRLMADELERFTSMRIKKE
KEKPNSAHRNSSASYGDDPTAQSLQDVSDEQVLVLFEQMLLDMNLNEEKQQPLREKDIII
KREMVSQYLHTSKAGMSQKESSRSAMMYIQELRSGLRDMPLLTCLESLRVSLNNNPVSWV
QTFGAEGLASLLDILKRLHDEREETPGSYDSRNKHEIIRCLKAFMNNKFGIKTMLETEEG
ILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLTAMTERAEMDEVERFQPLLD
GLKSGTSIALKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQDLREIENDDMRV
QLNVFDEQGEEDSYDLKGRLDDIRMEMDDFSDVFQILLNTVKDSKAEPHFLSILQHLLLV
RNDYEARPQYYKLIEECISQIVLHKNGADPDFKCRHLQIDIEGLIDQMIDKTKVEKSEAK
ATELEKKLDSELTARHELQVEMKKMESDFEQKLQDLQGEKDVLNSEKQQIATEKQDLEAE
VSQLTGEVAKLSKELEDAKKEMASLSAAVTAVAPPSSATVPLAPGTITPPPAPPLPRELT
IPPPPPLPGGDTIPPPPPPPPLPGHAYIPPPPPLPGSVGSSVPPLLPGEAGIPPPPPLPG
GASIPPPPPLPGGASIPPPPPLPGATVISPPPPLAGSTGIPPPPPLPGSAGIPPPPPPLP
GGAGMPPPPPPLPGGPGIPPPPPIPGGPGIPPPPPGMGMPPPPPFGFGVPAAPVLPFGLT
PKKLYKPEVQLRRPNWSKFVAEDLSQDCFWTKVKEDRFENNELFAKLTLTFSAQTKTKKD
QEGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMAYQEIKNVILEVNESVLTESMI
QNLIKQMPEPEQLKMLSELKDEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVE
NIKPEIVSVTAACEELRKSESFSSLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTK
STDQKMTLLHFLAELCENDYPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVER
DVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRLMHCNMEALYKELGDYFLFDPKKVSV
EEFFMDLHNFKNMFVQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNA
EGDETGVMDSLLEALQTGAAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMTAVPSKMA
KNNEGVSTILEETKELVGRAN
Download sequence
Identical sequences M3YA74
ENSMPUP00000008231 ENSMPUP00000008231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]