SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008291 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008291
Domain Number 1 Region: 22-126
Classification Level Classification E-value
Superfamily Lysozyme-like 9.92e-39
Family C-type lysozyme 0.0000655
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008291   Gene: ENSMPUG00000008354   Transcript: ENSMPUT00000008424
Sequence length 126
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897072.1:1162746:1169199:1 gene:ENSMPUG00000008354 transcript:ENSMPUT00000008424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGTLLMSLVSCLIAISQASLINRCDLARVLRKEDLDGFEGYSLNDWLCLAFVESNFNIS
KVNENADGSFDYGIFQINSHYWCNDYRSHSENICHEDCQDLLSPNLLSTISCAKKIVSGA
GGMKNW
Download sequence
Identical sequences M3YAD4
ENSMPUP00000008291 ENSMPUP00000008291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]